MZ@ !L!This program cannot be run in DOS mode. $ Eeeed;edeaefeleegeRichePEd["  C@ Q`A 1 ( 0 . 85 P6 .textz   `.rdata# $ @@.data7P .8 @.pdata. 0f @@.rsrc0 2 @B.reloc@BHHDH" D+Lъ E3A LBHT$xD$0AD$4I@I HD$8HAHHAHT$(LBJB AE3BD$pBHT$0IJ D$ * HHHDH L@HPHSVWATAUAVAWH0Lb % 蔦3ۄt*eH %`3A HI0& Hu H@uÄQJ0u 9u H$;H$;H$;H$?H$H2@$\$z\$x\$}\$|\${\$v\$w\$y$DD㈜$\$t\$r\$q\$s$$\$pH$KH$p;H$;H$;\$~\$uH$3H$H@L( AЄ:H$3H$H@L( AЄAEH. H$p1 EH. H$n1 EH. H$O1 H$肇 H ss U#  D;-AAAMDA*AuA@,TAuA8Xu @|$w#*AuA@,SAuA8Xu @|$v*AuA@,PAuA8Xu $*AuA@,RAu A8Xu@|$zӊ*AuA@,BAu A8Xu@|$r벊*AudA@,XAuYA8XuS$@|$xAKTH$0u H$H$X -AA**AuyA@,LAunH$8@|$tIPH$0H$H$1$ $H$*AWA@,KAHH$8:8H$h-8IPH$8/xAH, H$h.XL$(D$E3H$H$8{6uSA3H$8X0HHH$苆H$h8H$879$PtD3H$8/HHH$hH4HH$H$819$Pu$ph*AuA@,MAu @|$}&*AA@,IAH$6Ax:u_8\$q"8\$pIPH$-H$H$/$2@|$p8\$p@|$q$H$*AuA@,CAu @|$sq*AuA@,QAu@|$|;*AuA@,FAu@|${ *AuA@,VAuD*Au@DD;s~H$6 H$h6H$8H$D;sAAITHt1:*u D@$D㈜$H$,DDEDl$8\$zu8\$tu8\$pu8\$qu 8\$su8\$rtD\$8\$xRT$wEtAL$vt 4L$vt贍HtaH9HWt蔍HtAHEtvHt#H]Ht H`HH$HDnXH^8^@H^DHFPHN5H$=k8\$|t2H$H6PH$HH$Q 39$H$3H$LHu H$HIH@(Hl! HLxu2H$HHB0HB! HtDLH$IHH$I.tAE3H$I)tIuIIHL AKIIHL AH$?3E#9$0$A$;;CAAA;FDH$DADH$D4PfBAH$fPL$IH$I+f; u Hfu fGBH$fF4HugH$H$VH$HH@0H H5LH$H$?GAH$9H$HH@0Hg LHHHA(H$IOP ItH@(IH) HLu.IHL AIWpE3EH$'LIIHL AЊ0Dd$(D$E3H$H$n/uH$H$!u H$$EADL$zAEA\${ҁ@\$r% \$p% \$s% \$q% ЊD$}Ɂ \$t@ A A D D$0A$D$ADD$L$L$H$Eu8\$~Z8\$uP@|$u띊$t5DH$t8\$uu@|$~x8\$un$8\$|t!tH$HH$@AH$˄EH$HD$hHt$`H$HD$XH$xHD$P$pD$H$fD$@$D$8L$0D$xD$(DL$}EH$H$f$Df$DŽ$x3AH$\$yDl$D$0D$8$tBf;fADnXHf8^@HfDHFPHN/pL$vuT$wt D@|$yDt$yf;H$M.H$@.H$p3.H$N?H$HzH$zH$-H$-H$-A;fArHtHHHL) A8\$xtH$x$p$8\$yt$H$~-H$q-H$pd-H$>H$HyH$yH$0-H$#-H$-wH$-H$,H$p,H$>H$HayH$TyH$,H$,H$,H0A_A^A]A\_^[HHXDH D@HHUVWATAUAVAWHH 3LGa HH\$pH \$xHHL$`HE`LH"a H3 HEhWHu HHEHa HDHHM0HMHMHMHHHMLT$hH]]H (LH08H]@]HLU8H]P]XH]p]xH]]LUH] ](H]]LUH]]H]]LUH]]HLHHLH\$P\$Q\$T! H HM!H HM!AHt EH!EHc H A9]u Ds9_uHI輯u LIIH@  t]IIH@0r LHKHIUHH IH@(I; HuIIH% AA$<L\$THT$TINDEl LIHT$TuYDEuYHENE3 HHH@  HHG M'jHIp SDEtD$TD$TuH@|$PD$TD$T$@A:DDDpAL%@lj8\$PEu H@#tE3H@E3IXH@tLHT$`H@uCHH@\X" I$AE3 IIH@ p IHH@XHUHL$p t*HUHL$p tHUHL$p  I$AEA|$@E30IH@  L`H IyI$EE3 IH@  LD$`IHf IHUHL$p &HUHL$p HUHL$p 58II9`CHt H֋HH\$(E3MĈ\$ IHu;8u7Hju+I$EE3 IH@  HJ IbDp~HHP*`~Ht H,HHlDp8t.A%.=u8xtH@|$QO\$(E3MĈ\$ IH莌;_HHH HHD$XHHH-tY}Ht HHHHMHvLD$XAMH@"LjD$(OHUHT$XH V7j}Ht HMHH5Dp8t.A%.=u8xtH@|$Q EMAIH@:tHHH `|LHtMH&HIHIG HY IG(HY I_0I_8I_@I_HI_PI_XIGLMt@AHIwHH@Y IO NtIIIH1 8\$Qu6p%.=u8xtH8\$PH`MLHDpHD$8L|$0fD$(D$ CucA?u]Dt$TtAHNPHuHN@\$HHEH\$@E3ɉ\$8E3H\$03D$(0 HD$  F`HP9LHtHHH2 I$IH@H! tA+ǩA8\$@AHM0E3IH Ex HU`HEpHM0Dž NtsH#tcLIH@tIDHM0Hyu.I$AE3nIH@ V H I8\$PuA8t9A+A;w/v(DADADADAH!Ht!HMk!HMb!HMY!H]"HM0D!H8!HL$`.!H$hH A_A^A]A\_^]H\$UH$@HH$ H3HH/ HL$@ Hd$hHD$@WHD$pLD$`D$`0D$x@HL$0Eo y2}H@ HL$Pm HL$0HD$8HD$(LMAD$ HT$P HL$0L xH HMO HuH  HM9 HtHH3SH$H]Ht$H|$UH$HpHHHMokHd$PHd$XHMd$pWHD$0E3HT LHD$8HHHD$`HU HD$hD$@D$xOuHMcHL$` t{LEE3ɉ|$ HT$`HL$0(tXHL$0%)tJHL$@ȉA(HH A,HL$0)*tHHL$0HHD$P *u@2HL$`HcHMHENL$p@IsI{I]HHXHpHxLp UHhHHJS 3HcLH H]HMH$ HM'HMHMlj]HEH]]H]7]?HE/H]G]OH]]HEH]]t_H HMtK{6IHM't5HUHMt$HU'HMtHH;|HMHMHM'xHMoL$I[IsI{ Ms(I]HHXHpHx UAVAWH8HH H3HH R H 3HELH}H g}HMAHMHM HMHMH}}H}}HEH}}H}0}8HE(H}@}HH}}HEH}}WIb-O(tHt&H >HxHH Q HHHx@ HIFHHiHH1 HD$PHM`  H; H HG H H[ HMp HZ HMP HEPD$`0WHD$pLD$`H|$hD$x@H T E PHD$@HD$0HeP HD$(@t$ H T HDAv = DHU`H DHHMp Du +HcHfHHH@@HL$ VHt$hH\$`H|$pHPA^IIH@ tgIIH@0LHtH'HL$0L@L+B+uHuIt9H@(IHHuIIH2HHH!HHIHHH!H\$Ht$ UWAUAVAWHl$H3@2H!]wLLLHH\AGLMH!]LEfD$(fEHMwfEWIGHEHEHEE0E@E'D$  @DnHHtHhD'gHHE3HHMw3HEoE3ɉt$HHEoH\$@E3D$83HD$0HED$( HD$ EoDms\=q=@AD39sHeH}eHeeHEHB HEߋHkDT,DD0HAHMSHMׄt~A3HHtgIHAItSHM A;svAHMwHtHtHDgL$@I[0IsHIA_A^A]_]HMD @USVWATAUAVAWHHH3LHI HEfEHEEfEE3HE`HDEXDEHHEHEEDEPAHDAAEHG HWpEXL9BtfD9uHW`L9BDHM'E3EPDuH]taD8tXtTD8t E3tHÃut3D8t*AHHÃt E3tHIH+LuH}`HAHtHHfufD9uJA AvH]uIN03ҋHLM:3LHu AHEAHN<(t}D8tnI;site8t 3҅tHÃutF8t>I>IAĊHÈHǃtI;s 3҅tI;sHHψuDeHDePHM`MFIHHtIIHHfuf9uIHME39EXtExHU؋MHDAHHHA_A^A]A\_^[]@SH HH:LD$LL$ SVWH 3HBH=HWGx5HZHHLL$X3xHH;wu@<3@<3zHtH _^[H\$Hl$Ht$WH BAA+AD;HHCHH@ )tHEHODMHpH\$0Hl$8Ht$@H _H\$Ht$WH AHHAuHHf7du UE$DB5DJDEDM ?0 HHtL HQ2E$DM DEU4IcIcHȍB0HMDH3DLE3E3H8HK@L@;^D$HHE`HD$@HD$XDt$8Lt$0D$( HD$ wC`y+=5=#=HHd$`HXuHH Hcʸ HHH@Hk:HPH2ED9XRMHUtBDHPAM@ HRHPBDHcBHcJHHPHJJLBHPBDBHPBDHPNtD;X|D$HHEHD$@HD$XDt$8Lt$0D$(HHD$ C`=tH HHK@HD$pD$HE3HD$@E3Dt$8HD$XLt$03D$(\@HD$ C`xU$D HD$pk}HEEHMU$DEHEAHCh@ KxH0@@HP@`B @pBD XBL hHCxHHH8EuH@HCpHHH@HX HH@H58HPHuH= Hv0@HHK@HE8D$HE3HD$@E3D$8 HE(HD$03HD$XD$(-HD$ 7C`x ELxD9xu 4xHK@HD$hD$HE3HD$@E3Dt$8HD$XLt$03D$( -HD$ C`xD8t$mu AD8t$nt@Ljw} u L9spu@`HˉlH@H@H3ƩL$PI[0Is8IA^_]H\$Ht$UWAVHl$HH/ 3HELHEH HHMHEIHb HHMHAHEHMH]]'H]/]7H]]H]]H]H]E@0HMw*HuIvLEHIKALEHUHM}HMHtH HHyHIHUD?HEHf9HMHt }rHIHHfy\HIHUDfGHEH:f91HMHt }rHIHHyHIHUDfGHEHf9HMHt }rHIHHyHIHUD?HMHf9ȈG fOHMHt }rHI HHt_y uYHIHUDHHEHtE3fA~AA~IfA~ AFAEfD$(fAFA]Hۉ|$ HINLWH0HM6HED|$(WHELME0LEH}E@HMD$ E8F`xIm2HHu F`IvAHMHED|$HE3H\$@E3Dd$83Lt$0D$(mHD$ F`A;uAHA4HD9n`tIL39~`}HH63AHjEHMD9{vxL=H( HD$XAH}}L|$PH @H}DD THL$PAHӉ}wDMHT$PE3DL$(HM tIHL$PAD;srH2F`%HMH$@@HA_A^A]A\_^]DEHT$PHMwAEHD2HL$Pb@̋4H\$ UVWHH H3HD$p3HHD$`I!D$dHD$hH D$`v0HHuu3HDB HM@HD$`D$H E3H\$@E3D$8 3HD$0HD$PD$(-HD$ xHtK HtKHL1HL$pH3蹢H$HĀ_^]H\$Hl$ VWATAVAWHH H3HD$p3E2HD$`3!D$dHD$hHD$`HtH!Hq@H9u4H!\$(H\HHD$ LE3H9AAHt H0EAE/HHE3H蓦HHD$`Dt$HE3H\$@E3D$8 3HD$0HD$PD$(-HD$ HD=tx5Ht039Sv)Hi((Hs H0H;SrH/EtHxAHL$pH3)L$I[@IkHIA_A^A\_^LI[Ik VWATAVAWHHO H3HD$p3Lq@E3ICLICHD$`AM9&u5H\McHHD$ ME3e؅M9&@@-HHuhL3HIHD$`\$HE3H|$@E3D$8 3HD$0HD$PD$(-HD$ ž=AD܅xG AH|.@tH#HL$pH3ܟL$I[@IkHIA_A^A\_^AhIxJB J0B@JPB`DLh ̋lH8HH̋0&t!t~A~6t tu-ððà t% t~ ~ twð2ððH\$WH 3HH0DB UHP3Ht -HPHXf`@bq@u@8{XtS\LD$0HK@_HKPHt H{PHK@Ht@8vtӻHKHHtH;K@t@8vtHKhƃv3H{@AH{H@{XH\$8H _鋢@SH HHI@Ht%hHKHH;K@t HtSHcHHc@H [H\$Ht$WH 3DHuk90tXtu~HHHT$@HH@(VHPHH9D1~10L1@H ;X|띋X~HPHD9tH ;|2H\$0Ht$8H _HcH0L@E@SH HHKǃ HHg HC3fHHfHHHHHHHH [H\$WH Ht HtHn*HH\$0H _@SH HrH%f H%f g HHtHHHtHuƃtHƃHKHH;K@tHt HcHHƃH [@SH HϣHH0HH [H\$Hl$Ht$WH@AIHHL@t$ HHtK @'HtHHHt@HxH H2H\$PHl$XHt$`H@_H\$WH HHHHtHH7HH\$0H _HHXL@HPUVWHH33Hf\$h3HD$jHD$rDC(fD$vIcH H]3HMHEHkH, AHEHHD$@HEPHE HEHEHF@HMxHL$8HMHHMHL$xHMHL$xHD$0H]]H]ȉ]HHH\$H\$PH\$X\$`H]X]`H]h]pH](]0H]8]@H]]H]]H]]H]]AHHMHL$0LExHU]HL$0HHD$(LMHLEHHD$ HT$8^RHT$xHM<HUxHM'HEE3L HD$ |HQHT$xHL$8HUHHL$8HT$xHL$8mHUHL$8W8t)HT$xHL$88HUHL$8"ttHD$8E3L ;HD$ ~HtOL sE3D$ Hwt)HHtHH]LH@P tHMHL$xHMHMHHL$8wHMxnHMeH$H_^]HHX L@HPUVWATAUAVAWHhHeHLeE2HEWH LHE\ADm_EIt;AHMDm_(tE\HMNHuHM2IIH@ Lc3HDEH]oAHH;IHHH;~+HEHMDIEEHEEE3Hd$@E3HL$83HMgD|$0HD$(HEHEHD$ ;AF`D=u H+3LE#;t_EM;uW}_tHUEIЙMDm_LcEHIH;AHMH$HĠA_A^A]A\_^]IHtDAD|$(#;uHELiHD$ LMϺiLD$ LƊAwAN`t'nt?vt D'@SH DAHًHIHC CHH ["H\$HT$UVWHPHIAHH@ HHϋH\$xHBHHL$p8 HHuG`23HDB8RHd$@HHC L>H$LHC3HD$pHC(HD$pHD$8t$0s0HO@Hl$(H\$ G`#;u H!yH$HP_^]HHXHpHx HPUATAUAVAWHhHLLMAM3HEHH[A\DnI@AEՉUHuHML<HL#L}IIH@Lc3HDEH]gAHDH;IHEAHHH;~DD+HMEEHEH@8utHEHHEHE蹖HEHt$@HMHL$8E3IN@E3D|$03HD$(HEHD$ JAF`D=uE;QAAH+HU#;DAHEH;4@8utzAIN@HEHt$@E3HD$8E3HE3D|$0HD$(HEHD$ HUADAF`A#A;tlEI;udHUHM趕u$HEHEAHH;DEHEIHpLMLiD|$ QIHAAD|$(A#A;uHELiHD$ 蹆LMLHT$ i蚆2MMAAt#t"AA;AArDAD|$(#;IuKHELiHD$ !EtzHELٺEN`iID|$(HD$ 讄NLMLHT$ iօEt/HELLMߺiID|$(HD$ cAHM@L$I[0Is@I{HIA_A^A]A\]H\$H|$UH$HH H3H3D$PH@bHD$XLD$`HXH|$`HD$pHgHD$PD$h0HHD$xE3ɉ}3H}}H}}H}H}}H}}H|$ 7C`HK@HED$H E3HD$@E3|$8HEH|$03D$(MHD$ C`x>f9Es,EHUHHf|Euƃb C`#2HH3L$I[I{ I]H\$WHH( H3H$Hy@LD$XHD$ HHT$`AEЅyD$PjD$XvVD$HHD$pHD$@E3Ƀd$8HD$`Hd$0E3D$(3HHD$ ݫЅxD$xt v23҉S`x u ƃu2H$H3H$HĐ_LUIkHH& H3HEO3D$HHEE3HE?E3HEG3HEHE'HE?ICHED$8ICHE/D$(X@ICE(Ex@E@M? EA EB ȃrMGEH ȃ(uEI$2HMOH3HĐ]H\$ LD$HT$WHH> H3HD$p0Ha` HH@HcHHH$H@d$HE3Hd$@H$E3H3D$8H\$`L$hHL$`HL$0HL$PD$(HL$ HOHG`x4=?tK=tD=t=L$HH$ƇHL$pH3辊H$HĀ_2H\$LD$HT$UVWATAUAVAWH0MHAMu$IH M;IILL5}`st }`u,HHHHH+HT$xHHLtƒ}`L$u5M;} L;sDI;aH\$xL+L$DIEHIHNDhAHH@HHH=HNHH@HHHH$3H~1E3AHT$xHL;~ HHIH H+EHE3NHJ}`tCMt>DFA@A;vNIJ JHuJLD$ IQ u7H1[J HH H+HHJHJJ H+J ÃAD;YHHHHtH2H\$pH0A_A^A]A\_^]HHXHp L@HPUWATAVAWHH`eHHEHH= HMWHEEܽD\HMлHt|HHAHĩ3ҋ3HM@DsH~VLeHH+H;}+LE8DHVHLLHDLLd$ tHM@IH;|E2HML\$`AI[0IsHIA_A^A\_]@SH`yXHtHyPuƁƁ\HIPHuHK@d$HHD$PHd$@E3Ƀd$8E3Hd$03D$( HD$ eC`tƃH`[@SH`yXHt HyPuKHIPHuHK@d$HHD$PHd$@E3Ƀd$8E3Hd$03D$( HD$ C`H`[@SH`yXHt HyPuKHIPHuHK@d$HHD$PHd$@E3Ƀd$8E3Hd$03D$( HD$ oC`H`[H\$UVWHl$H@H H3HE8HLEHEIH W3HEH]H}EgDW@8t D90M0DLE}DL$dAAEHE@8tVHEE E EEEE EE E E fE HAHD$PH@H8HHHIHEEIHIH@H_HD$pHuHpWHH΋\H@ D$PDHM-HuHMH+H]HtE3LHxlj|$lD$\9}|$TD$`dHN@E3ɉEE3E3ҋD$dD$HHD$pHD$@@8tiD$8DHEHD$0HED$(,HD$ AHUHM0F`lA$HUHMXAHU0HMD,D$8HEHD$0HED$(HD$ F`9~`H9}HDD$PHLHT$TLMH@9|$\9|$Pv}D$TȉD$h؉D$xHDHLMHHH@RuHMLD$XfL$hD$xL$h;D$PrH]D$`3u;D$lv4ȸd;GȉL$lHtDLH˺vD$\L$TL$PD$`dD$\L$T;EHL$p @8u;0u2Ht!LEL˺@|$ H@HnHL$pqHL$pF`=t8=t*=t=t=t( 0 Ht HtHLYu@}HM_EHM8H3蔀H$hH@_^]H\$Hl$WH`d$P3HىD$THD$X8tA` ` HHtiD3HۄOHD$Pl$HE3H|$@E3l$83H|$0GHK@D$(-HD$ C`ƃHG{`H\$pHl$xH`_@SH HHHHm HCHH [H\$WH HχHH6tH HH\$0H _HA HH HA3HAHAHH\$WH H(t HtH^ HH\$0H _@SH H/HHHIHt ' HcHHH [H\$WH HyHt2bC- HHt3AHH{C2cH{C H\$0H _H\$WH AHt:LAII;r'H HtHHH#HH;_sكgH\$0H _LAMtyv ;QsI3H\$Ht$WH 3HHHuMHH@ bt"HGH94tHHH@ @;rHHH@ ,;BˋH\$0Ht$8H _H\$Ht$WH yHًIH;rS H;r2HCH4ȰCH\$0Ht$8H _D;AsHAEJ2@SH Hٹ y HHtHbHHH HB3HtJHZHH [̋AHRH@`H%H\$WH DA3HA;s&LQD+‹AII H9IݙKHH\$0H _H(HQL HILEA-H(H(LAQHIH(H\$WH HًHIHu H  HtHC{CH\$0H _H HHH@H%LH HIH@H%HHXHhHpHx ATAVAWH Dq3AMLHHHH@HMHHIHHAI.ȅ~DA.;uny9tmHHH@HHHtSIHAI؛?u8;s4HHH@HHHtIHAIx;r̋H FI$3H\$@Hl$HHt$PH|$XH A_A^A\H\$WH H(t HtHHH\$0H _@SH HςHHH HH [鷰LL$ HT$SUVWATAUAVAWHHMEHD;AHvHILL$ ELHQ@QL3$DFEA;H$E3HD9gHvbHO@3Ft8AHGXHT$03HD$0HO@3F,uL$AHG8J;tHG@B ED;gHrAA;s2{HW0$DGLJIc|HG@AB $+(HOL$DDHQ@MH$IHD$  A;DH$IHWX3A3DGTuWP3HO@Dt+AHWX3WP3HO@D,uL$GPHO0H$DGLH Io{OPAHG83MHȋOPHG@ GPAwHWP$OTH$M+/$AA;AHHA_A^A]A\_^][2H\$Hl$HT$VWATAVAWH03MEH9qHv>Df HSX33HK@D$uHC8H HC@ A;sHrHT$hCMHKELjD$ H\$`Hl$pH0A_A^A\_^f@SH HK H'HH9 H HzH' HH`H HHFH HH,H HHH HHH HtuHH Ht_HH HtIHH Ht3HH HtHH HtH2H [@SH H 3HtH H HtH H HtwH H Ht_H H HtGH H Ht/H H HtH H HtH | H HtH l H] HtH \ HM HtH L H= HtH < H- HtH$ H [3H\$VHH0 H3H$L$$HD$  HT$ 335 uL IE3HT$03EA@Xy 3E3HT$pAXAI.x֋D$8D$HL$XH+L$PLHI;LBILDIwE3HIHL+LY I;teH %`L3HI0HtH), ) H$H3qH$H^HHXHpWH HH@LeH %`3HI0FH HT$8335 uH Ht HH eH %`L3HI0 o H\$0Ht$@H _H\$Ht$WH HeH %`L3HI0HH;wH+HHtDHH.uHtHHH\$0Ht$8H _H(;H` Lz3HAHLǁHH(H\$WH H(t HtHnHH\$0H _@SH HzHHt+H`lHGCDHXdƃHH [|;H\$ UVWAVAWH$ HH H3HH E3HL}H LvD}MHL$pMHL$@{DvLHMZE{DHL$pHD$xL}D}L|$PD|$XHD$HL|$`D|$hL}D}HEL}D}fD8{@t@Hbu HT$pHj'LMD$ HL$pke;-t-)-t=]u9dLMDL)HL$@{AHMzHL$@pHL$pf@HH3mH$(HA_A^_^]AH6HM識tIHUDME3L$(H:{Lo\LHL$@ML“|2HL$@@t$(E3AD|$ -HH EfH|$8f@fD$0fD$2D8{Au!D8=@ u `@51 HL$0HLe|#fHL$piǃe 8! t I3AL$ L?HL$@|@t$(HL$@E3D|$ AHHL$XfHD$8f@fL$0fL$2D8{Au!D8= u 6@5 HL$0HǃKǃWrǃ2cǃTH\$ UVWATAUAVAWH$H0Hj H3H HL$x E3T$pL!eED$`HHt D3HsoHHHt L3HVoA@AHELHt E3H/oIHEHHt M3HoAApHEHtE3HnHEAdHMHHHG4HEHEEIE3HD$hLI?tH8bD$`UDLHMHUHM+3E0T$PHEHT$HH HEWDBHUDD$@DD$8LEȉT$0HID$(HT$ LȺE@EHEy$=4=HD$hI'HeJeLEHeWHE0E3HED$ EՇ<Hd$@H[HME3HUE3H HHEHD$8HED$0 HL$(IHD$ >x"AHD$hHIHD$hdvH H$J ߅J$HD$xHT$tDx@@@-ظA D;uHL$xLDʋT$p\Et HEAAHD$ HAHU=uA΅xL$tHUHD$xDx@EtH H$H$AdLm3LIHtHIoIA;rLmEtHEAE3HD$ HA8EHt%H H[AH Ht H#EuHt%H H[AH Ht rH#EuHtH(HtHMtIHEHtHHEHtHD$`H H3UfH$H0A_A^A]A\_^]H\$WH H"M3HpHHH HHBzHHtHHHHHH HHlHHHH4 HHHFH_ H3HDG,@RHi3H@HHfPHXH`HhHpxH HCHH\$0H _H\$WH H(t HtH>HH\$0H _@SH HWoHHHHH [TLHHpHxLhUAVAWHhHD}_HVqeHHeMHeLeefeeeHeHEHrHEHK HEH8 HENjEgD$0D|$(DL$ MLLuCMH}IHIEHd$ LE3ۉtEuHHu3HMWL$Is I{(Mk0IA_A^]H\$Hl$Ht$WHP`AIHUHt HH3HuHtLHW3D$DΉD$(LNJ$HHˈD$ \uHHHԄHH\$`Hl$hHt$pHP_Hx}LD$HT$SH JHH;A\ztAHNuƃyLD$@HKxHT$8LD$@HT$8uƃx fǁxHK0_H [HLD$HT$SH HMxfJH;A\ztAHxuƃxLD$@HHT$8{LD$@HT$8uƃy fǁxHK0zH [H\$WH H HiHnH HOHTH) H5H:H HH H HHH; HHH HHH HHHe HHH HHH HeHjH HKHPH H1H6H HHH HHH HHHU HHHC HHH1 HHH H{HH HaHfH HGHLH H-H2H HHH HHH HHHq HHH_ HHH5 HHH HwH|H H]HbH HCHHH H)H.H{ HHH) HHH? HHH} HHH HHH) HHH HsHxH% HYH^H H?HDH H%H*H_ H HH HHH# HHH HHH HHH HHH HtsHxH} Ht]HbH_ HtGHLHA Ht1H6H HtH H HtH2ۊH\$0H _HHXHpHx UH` C`H+H H3HP3HbHD$ HH' HL$PHD$(H\$0\$8H\$@\$Hf\$PH|$Pf9\$PtrAHL$ HdtiHVHL$0xtHfu7D$8HT$PAH HH+HQHHHHϋL+M yf9uHL$PHL$ iHPH3ZL$` I[Is I{(I]LAH+HBHED+EAEɋH\$LDR At3fD;t7fD;t,fD;t!fD;tfD;t fD;uB A*A@f+f~w0HxAuIwMHwIHU_IH@(mHULHzt0H{tAuICwYMSHWt8IHU_IH@(mHULHH$tAuIvMHt8]HM!LD$ MHUHM:HM蹉IIH@lHU_I΍@HEHEIH@(lHULH,u'IHU_IH@(lHULHt2HvAuIutMtHzvIuu@HMHM~H$@HA_A^A]A\_^]H\$LL$ UVWATAUAVAWHl$H3HWHEWH$ MHELHQuHELHz HEHEEHuE@0HuH@k3D~ȻA;sAIIH@~k3ҋHMOIHUIH}_H@(IkMƉ\$ HUHMLL+OVHM·u9IHUIH@(kHMHHH+HHHE蛇H]IHUIH@(jHIIH@jLMwLEH\t'HED8MMHUMINIHUIH@(ejHH+M_H;IHU_IH@(AjHMHHH+HHEنtWIHU_IH@(jIHHAIiLMwLEH tCHpIPs@DHMa}H$AHĐA_A^A]A\_^]LI[MCUVWH03IHH\$`90tMICLMKICu2`8\$`tVHD$`LLL$PHD$ HHt8\$`uH3sHrtHtHsHrtH\$XH0_^]H\$Ht$ WHPH H3H$@D$(LL$@AD$ HHu3Hu'2H$@H3jFL$PI[ Is(I_ËS\JfDL@HH=sVE3ft@E3HT$0HL$@cetT$0AHD$8HHftPHT$8$qHL$07ef{GHHXHpHxLp UHhHHV 3HH]H L]HMHHM'HnAHEHMH]EƉ]H]7]?HE/H]G]OpEHjoHM'qpDMHUE3Dt$(HxDM?HU'DEHDt$(wuEHmHptYV?MA9GuI;Os HGHf:u-H3HH@ft3DMLHstHM'0yHM'yL$I[IsI{ Ms(I]H\$Ht$UWATAVAWHl$HHewLLHnHM33aH!uHEWD$( LMHELEE0E@HMwD$ E'aAFDL$I[I{ I]@SVWHpHv H3HD$hID$ LD$@HT$0A(H\y20D$`LD$@A(HT$0|$`HD$ x]HL$hH3=Hp_^[H\$H|$UHl$HHeAHEuHALMd$(LE'He/WHEAHMfE'0fEfE HEHE7E?@EGD$ <[=t=4uEd$PLMHd$HLE'D$@@HMD$8d$0D$(Hd$ Zy2IHd$@HEHME3HME3HD$83҉\$0HEH|$(HD$ 9ZHMmZL$I[I{I]L u IH;HvH Lu I;rI;tH I;tHHH HT$SH Hd$8HT$8MMHMtAHL$PHtHD$8HHT$8HpMt@AHL$XHtHD$8HH [@SVWAVHH4t H3H$HI3HHL$ MDB@Y@3HL$`AXG@E3HT$ 3EA@oZy2[E3HT$`AXAIOZxL$(HtHt $HHtD$,HMtHD$H3H+D$@HIH$H3;HA^_^[H\$ UVWAVAWHl$HHAs H3HE/eHHHEIH LHEL3HMHEW!E#E3EpE'P upHH]3HEE3HEE3E3҉D$HIH\$@HED$8 HD$0HED$(-HD$ X; u}{ uw} uqMt,{HWfsCHUHAIet@Ht>H3HH@[t%HHfDKHDCH@([u@2HMNo@HM/H39H$HĠA_A^_^]@USVWATAUAVAWHl$HHq H3HEHEwMHELHEHHE3H3GHMHEHMHX WHEE33LMHE(HE]]EoH Du3H}E3Dt$HE3H|$@3HEHHEHED$8 HD$0HED$(-HD$ 3W?($}$L=oesMtGG Iׅt-J 7$rA;sHHH;s 8tHH;rH8eIc@MtGGIׅt-J 7$rA;sHHH;s 8tHH;rHdI`cLEMtGGt-J 7$rA;sL<IL;s 8tHH;rL=dIIcHMHtG LuME3EHMExAmtqH}3HME3HEE3HE3ҋED$HHEH|$@D$8 HD$0HED$(-HD$ UxD9?uD9uD9}uG A @@@HMrl@HMH36HA_A^A]A\_^[]H\$ UVWHl$HHn H3HEHI3HHMDB,;3HMDB$:CWfEfD$`fD$bHC3HD$hHD$`HEE$E0H]E@EHtD$(LL$pLED$ HL$PSy2HtHL$PHED$H,E3HD$@E3D$8$HEHD$03HD$pD$(` HD$ .SybHL$P=tSD$HHD$XHD$@E3ɉ\$8HD$pH\$0E3D$(x 3HD$ RxD$X$EȉHL$PRHMH34H$HH_^]3HBHAH HAH?Q HQ(HQ0HH>HQ8fQ@HQDHQPHA`H} HAhH HQpHQxǁHAHH\$WH H(t HtHHH\$0H _@SH H/?HHH`$HH ['@USVWAVH$pHH#l H3HE3H:HD$@HH8 H`HHD$HHL$pLt$PIDt$XLt$`Dt$hPVDHL$@LLHL$@\$(E3ADt$ dbHHL$XfHD$8fL$0fL$2D8vXu/~D't&D8vAu D85 u P{ HL$0xRD8v@tH 'u HT$@H.D8vXt=3H&t ~D u&D8vAu D85% u -P HL$pR~D'tLMD$ HL$@MbHAHL$@fHH3%2HĐA^_^[]H\$Ht$H|$UHHpHeH 9eLXHe@eHHEHMHl HE؊ҁ St}D$(HMЃd$ E3A`HHt[MfHEȀAfMfMu = u O HMPH%u HUH.-H貿HMeL\$p@I[IsI{ I]@SH Ht HH3Hu3Fc8HKc<cDcHCXC@HCPfuHHHRHH [@SH YXQXtuL WO%H [Ht:H\$WH مt H8_@tH<u HT$0HLL$`D$ HL$0NHtHL$0OSH$`H3H$Hp_@SH 蒫HW HyHxH] H_H^H+ HEHDH H+H*H HHH HHH HHܪH HHªH HH訪Hʼn HH莪H HuHtH H[HZH HAH@H5 H'H&H# H H H HHH HHةH HH辩H HH褩H HH芩H HtuHtHq Ht_H^H; HtIHHH5 Ht3H2H HtHH HtH2H [@SH H 3Ht7H ć H HtH H HtH Hu HtH t He HtשH d HU Ht迩H \ HE Ht觩H t H= Ht菩H $ HU HtwH < H Ht_H  H HtGH H Ht/H  H݆ HtH H HtH H HtH H HtϨH | Hu Ht跨H l H] Ht蟨H  HM Ht臨H D H HtoH 4 H% HtWH H Ht?H ą H݅ Ht'H H HtH H HtH He HtߧHt H [̍Buu L R 3MA9tIHcHRrHcAD@SH HN3H%HH(HHa HHH`HhHV HpH HxHHCHHH [H\$WH H(t HtH辦HH\$0H _@SH HH$HHHhLHMHZ HHH [|H\$UHl$H3E HE]oHELEHEg]gKHEMHEoMH EKH]E3HEH]]'H]/H]7]?H]G]OH\$ 7x9]gKE؊H$HĠ]H\$Ht$H|$UATAUAVAWHH`IIDMPE3LLH{u3LI\tEXHt6D8au-(HE3HH@ EH8H6=HN 뢋0Du`u#EuHt L=HP quUD8su_t EtVD;tQHt+L<H H3HH@0,8Aą@D8bt 6D90tL98uH6VD8uH蠎uuuH0 ;vuA toAF;vgHUp4LDd$ MAHˋ躏؅x MpHUh_4IL\$`I[0Is8I{@IA_A^A]A\]HtE3L3?H HUp3DD8qtD8stD dDH"DeHEHMH~ WHEEJE3HMкJHDHH3LeD;tIA3AI|$(AMD|$ HH;uDD;vE3EL`M~HtLwA7HHMmIEx MpHUh2D;tAjH_AdL=Hc=|HMIn̉T$SVWATAUAVAWHEHHL$p@2Lt$pMMEL$ L|$\H$@HLEL$@HuHL$p21tu&auL`9lIAH$1DD$Tt tƆ~HtCCHHLP`H$HHD$(L|$ EMƋILK4AJHHH$HHT$8L|$0$8fT$($0T$ EMƋH@@L3A҈D$P@ExHT$X$0؃|$T|HT$X$0H$@@2@|$P$AuVt'nt?vt t2t!L7u{H$   ]H >D$0pHD$(H<HD$ <AEAH$ bLi7eH$ HL$p@HA_A^A]A\_^[H\$UHl$H3HMH@H]E3E$LEHEK]H@H]]H]]'H]/H]7]?H]G]OH\$ /H$HĠ]LI[MCUVWATAUAVAWHPLL3IKAIBd$IS$y/x HL$@Huʚ;E4HgfffffffHl$8I8HD$H3HHH?HȋA$HDkd33HL$@DD$0ELD$H$$DL;pLD$ HI|A`A`LHI;}XDD$ D+AD$HIL${uIHL$2HI;|Ld$HH$3HL$80.HL$8H;$Hc$D$HEHHII;tDHc$Hl$@HHHHLD$MtELG8ItCIIH;}>DD$0IAE3 IH@ /Hg4I3H;}]DD$ D+LHIzu@LD$ AHImzuIHL$tHH;|Mt,D$Lv7D$IfH$HPA_A^A]A\_^]LD$LL$ SUVWH(3HBH=HWGx5HZHHLL$h+xHH;wuf,^f,^zHtf.H(_^][3HHHHAHv HAHv Q HQ(HQ0HAHHQ8fQ@HQDHQPH\$WH H(t HtH~HH\$0H _@SH HHH3HA8A@HADHAPHsAHHH [DADA vHAt?A(t9A t-At-At'A*tAotAtA#tt 2ÄðHHPL@LH H(L@HH@(8-H(LD$HL$LL$ SVWAVHHH3DpDqHtHSP3)3DsHuHAE3HH@ ,L$HH$HH@(,D$0Hd$8KHD$0HHA^_^[HL$SVWATAVAWHHAEDH3D`DaHtHSP3$)3DcHuHDEAHH@ 1,L$HH$HH@(,D$0Hd$8KHD$0HHA_A^A\_^[LD$HL$LL$ SVWAVHHH3DpDqHtHSP3(3DsHuHAE3HH@ +L$H$HD$0Hd$8KHD$0HHA^_^[HHPL@LH H(L@HH(DD$SVWATAUAVAWHHZA H3H$ALHL$HHL$PHT$@EhADl$8HAE3iH@ *E3AEgA EQEAf|$4A;~Af\$0fA;(;F 6IHcH$H HL6+B 6'A.t B6fDtXfDDtXA EQp\$0[Hc¹?fDBHcȸ?fLBHcȸ fLHfL\XE3D`DDPDLt$@Dl$8|$4HD$PHD$H$P6IHcfDDBHcfDLBHcfDLfDDDXfDŽ$ fD|$xMLt$@LL$XL$H5HL$Ht fcH$H3HA_A^A]A\_^[H\$ WHpH(? H3H$`3H HHD$0H=p HD$8H\$@\$HH\$P\$X8Y@t?ML‹QDHL$0.`t*LL$`D$ HL$0K6HT$0H6HL$0:H$`H3H$Hp_H(XE3HHtJH 0p HHHHBH p HJDB LB(LB0HBLB8fDB@LBDLBPIHH(̊HH ,0HĉPL@LH H@H\$Hl$Ht$WATAUAVAWH E3MHHD8y@DyHEhIOXNHALJ`? IIX~H\$Hl$Ht$ WAVAWH0yMAHHt2HXǃ` HHXtN@2DC MHHA@#D+HD$`D;HD$ DGDD$`tT$`C$HL+u@HKXsHX@Ń`H\$PHl$XHt$hH0A_A^_DLQ(LpAM;vM+L H\$WH IHu&u!=wHD$Pƀ3H\$0H _H\$E3ILfD;sGIJEfANMI@JJIJNDIJJHJNTIHNfE;rH\$H\$Ht$H|$LIAHALcxdMIICL+LI I;wH2L;rrL;wA(IH;rbL;w HAI I;uHAN\HtNIIy3H\$Ht$H|$LA I;wH2L;rI;rA(IH;s HAHHI;uHAHH\$WH H(t HtHXHH\$0H _@SH aHKHHHIHt XHcHc H.HH [@SH aHHIHt eXHcHc H [H\$WH HA HAHt;QwHt3H\$0H _Í:Q;rVHCHtHHHH#HC H\$Hl$Ht$WH HAHI Ht;{w Hui7;r`EVHHtQHLHHH#3H9{HS HBCDHKHt VWHcHkHs {2H\$0Hl$8Ht$@H _@SH HaHNHHH2 HAA !*6 H 6 H [H\$WH H(t HtHVHH\$0H _@SH HaHHHA 5 uH%5 H%5 ȉ5 H z5 HH [H8HILL$ ELHQ@0H8H8AHID$ `4H8HtH"MtI H"2AH\$WH HzH 0 H,3HkHHC0HH@H>HCpH[HHHHHHHHHHHHHHHHHHH H(H0H8H@HHH00 HPHXH`ǃhHHKPHHHH{ {,H{@HH{X{`H{hHpHxHHHf{dHH@{fHH@H\$0H _H\$WH HHHfHHHVFHcHHGpHHHGptHgSHH\$0H _HHXHhHpHx AVH Hy@H HLHt;3ƃHHt E33HHHHtH39kHv3HH{@IHHtHuH7H;u;kHrHC@HtHHHtoRHc@HHHH@(HHtxH\$0Hl$8Ht$@H|$HH A^LSH HHHAIcIcHBHQHHHQH HIH HBHAHHJHHHRHC0Ht2ICMCHCXISAH(H HIC%Hc0HK@Ht Hc@HxQHH [@SVWH HAHQHHH:D{`tHH΋{hH@;rGt{du 3Ҹ{eu HǃHH{aǃ uaLL$PE3HT$HHL$@THT$HHL$PH;rHHHHD$@H‹3HH;vK$ClC$HHH@ȉC(3ҋC GS$H{HHH@HHBHNHt"H8HHHHtHH@HHu3HK@HtGHKPGHHHL$XxH?uH@BHkxH H>2H _^[H\$Hl$Ht$WH Y HHAHHH#HPdDW 3ҋOHHI3M HLILG@II;t3HA IH;wH;wI;sI;sH ڀyHA<tALeG HH;rHOP(H\$0Hl$8Ht$@H _H\$WH Hٹ 9K$vqS,B;BC$;v_H{0H9?tVLII MAIAHAIIQIHM MIII@HBIPIHMM@K,C,;C$wH\$0H _HHXHhHpHx AVH y(My HHمHP%DC$HtH3HȋHHL D;DBs,MtI3HȋHHA;HAGDC$C,;C$w;vYLK0M9 tPM II MAIAHAIIQIHM MIII@HBIPIHMM@ K,HKPpH\$0Hl$8Ht$@H|$HH A^HHXHhHpHx AVH y(Hy MHPH Mt DK,LMHt S$HHHKPH\$0Hl$8Ht$@H|$HH A^H%@USVWAVAWHH8A,E3ILu@HALuH;A$i rj;rVDLEPHM8E33豁u3HDwfHt,E8HEPH;w3mGfD8qfhdJHHt8HH@HHH@Ls Ds(Ls0Ds8DsLDsHuPLHDE 3ҋMHHI3M$HLILu@II;t-HH IH;wH;wI;sI;sHI;uI;HHHIEHIE@E IE IH_ INHHHxH9HOHsHOP3OLO0D+Lo`EHMHH|$(`H΄t3E HI;GLHG<=H H\$`Hl$hHt$pH0A_A^A]A\_HHXHhHpHx ATAVAWH DA333DDwD;vu3ɅtL3AA0tJI;r;r3DHtH9 H7HtDHD4EAE;rHtH8AH\$@Hl$HHt$PH|$XH A_A^A\Í4?;rA;rHtH8FHtH8GH\$WH 3HH\$8H\$0OL8_AHT$ Hx3HH !HL$(H3_H\$PH0_H\$WH0HH3HD$(d$ HٹfD$$H~9s2*AHT$ Hkx3HdHL$(H3חH\$PH0_H\$WH0H#H3HD$(d$ HٹfD$$H9s2>AHT$ Hx3HܷH ȷ HL$(H3;H\$PH0_@USVWATAVAWH$裛H+HqH3HpLLٺHL$8MIwAHL$8Hfxu~btzti uAHL$po t.DKDCHT$`HL$pT$dHL$pE 3HpH3,HĀA_A^A\_^[]HL$pLLt$ DHL$pLLt$ DHL$pHL$p돺HL$pAVyLL$pMH׋ZALD$pAHL$8ADHE3HD$(LD$0HT$8Ld$ 3HL$0ueH %`3LD$0HI02HL$0AHD$0@SUVWAVH@HbH3HD$0IIHAt0MADHy2sLDAHxEHT$ A H.T$$EHxt,LDAH<xLDAH&xHL$0H3;H@A^_^][H\$UVWHHH3H$H$HT$0HD$0@HL$PIAu2AHXxHD$PAAHD$ Hx…t.AHt$ DHxAHl$ DHxAHT$8HEA T$H"AHT$ HEA TT$$H@t0tH$PH3荍L$`I[Is I_@SUVWAVHHH3H$H$HT$ HD$ @HL$@IAu2AEHxLL$@AAHxÅt,LDAHxLDAHxEHT$(A H8T$,EH dLL$@AAHAEt4LDAH#'LDAH  H$H3HĐA^_^][@SHPH`H3H$@AHny2;HT$0D$0HL$@ktHD$@AAHD$ H H$@H3胋HP[@SH HǚHH3HAHA HHA(H03HH0H H8HHHH@HPHXH`HCHHKKH [H\$WH H(t HtH.HH\$0H _@SH HHHHIHtHcH0cIHK 5GHnHH [H\$WH HHIHtHg _9HGHtBHO XGt0H0HHHK(3C$A HO肎2H\$0H _A;v3HI@H0HI@SUVWAVHPHH3HD$H3HD$@AADHD$@HAH9StHHuHuSH FHHu2HGL .LfH|$ H:H H HKDsHGHE3HKHT$@EAHtHPA HL$0}+t$@HL$0AnHL$HH3gHPA^_^][H\$ WH@HH3HD$8ADʃAD$0AHAJ Htz9QtH HuHthHYHHT$0HtQHPA HL$ ɨ+|$0HL$ AʨE3HL$ APuHT$0HHL$8H3莇H\$hH@_H\$Hl$Ht$WH@HIIȋu2HGˁHHtx9ZtHHuHtfHd$ HrHT$ H.HHtFHPA HL$(3HD$0HsLD$hHi uà r뤰H\$PHl$XHt$`H@_H\$ UVWAVAWHPHH3HD$@LIȉD$8IDu2u33IGHRHKHT$8BHt;HPA HL$(HD$0A+L$8HsSLD$ HtHHuHrHL$@H3݅H$HPA_A^_^]H\$Hl$DD$VWAUAVAWH0LLH#u233IEHaHd$xE3)HPA HL$ NHL$ {DAsHT$xHK[HuSLD$pItHHuHrH\$`Hl$hH0A_A^A]_^H\$Ht$H|$UAVAWHHHMHML7H9H "SE3HeeHMHMHE7t}HMutp3@h9svREM#DHEH Dr-}v ƃhLML|$ LEЋHSt;srhA@2HMHM7L$@I[ Is(I{0IA_A^]HLH L@PHHSUVWHhMP HAHDIIAH#ʋIC u2HF3H Hi$9AtH HuHLH!\$8HAHHD$@HT$8DHH$3HFA HL$HHHD$PHL$DDAACAKA#DIC H Ds}HMA H;At H HuHuIHHtHcxH&HHHC3HHLD$0H=}vH$ƀh+H$LH$MAHD$ 7HF HL$@HT$8HHHkxDHT$@H\$H$D$8t2HHt9HHHHG$HHHHb3Ht$HH$G$GHH@*tC;@H$H͋}HtHHH@Hh_^][HHH͢UH\$WH H(t HtHHH\$0H _H\$WH HyHƏHHtHCHH8HtH{HucH>HH\$0H _H\$WH HyHtHCHH8HtdH{HucH\$0H _H\$HT$WH HyHٹ HCHuH{H8HD$8HKHACH\$0H _̅t@H\$Ht$WH HHKH1Ht KHsuH\$0Ht$8H _HAEtHtHAuHuH!H@HHH\$WH H(t HtH> HH\$0H _@SH H?HH,HHH [@SH0HHd$ HKL LHqH0[H\$Hl$Ht$WH J<HH@H;})LD$HHHt @t@@2HH;|H\$0@Ht$@Hl$8H _H\$WH HZHL@HL+@HPIdt3HHuհH\$0H _2HT$USVWAVAWHHXH݌HUHELqH3HEMHBAHHEHUH]HLEHINHHtOHEH9Fu?HUHI7LHE@Mt HPI9PuIXIIH^sHFmAkHE@LM8HLEPHUHEIHEU8HHE@uHA.T$(E3HEHUHEIHEPEA HD$ HtHGxHXA_A^_^[]HT$USWHH@HHUHEHyHLM HHULE0HEHUHC} HupL@L;@uHU0H3SHE(L;u HHBAH9Bu HHB2HHE3HMHHJHMHHBEA HU3HtHKxH@_[]H\$WH HyxHt&Hy HHHgHuH!CxH\$0H _H\$Hl$Ht$WH J<HH@H;}$HHt @t@@2HH;|H\$0@Ht$@Hl$8H _H\$WH HZHL@HL+@HPIlt3HHuհH\$0H _2H\$Ht$LD$WH HqHHβ3`HtDHHH+HHHHL$@H;3H8HuHL$@HtH@H+HHHH'H\$0HHt$8H _LSH@HA3ICH<ICMt$I@ISHHISICHtH@[HHXHhHpHx AVH HiDHͲII3mHHt6A;t3HSHHuHtHAHHAH+AHHH&H'H\$0Hl$8Ht$@H|$HH A^I@H9B}3IH3H9J̋H(HtHH(H\$WH Ht HtHHH\$0H _H\$Ht$WH HaHHYHt=HKHt uHcH#HcHHuHOHt OH!wH\$0Ht$8H _@SH HcHHtHHH [@SH HN3HCHtHPHHPHHuH [H\$Ht$WH ML\$0HLMEI D3ADAL3AH~AL3AL3K@LTMt&H E3MH~IM@H;t!AAH;|AH\$8Ht$@H _HuIHdHAHߋI IHHNH\$Ht$HT$WH HLI D3AH~DAL3AL3AL3K@H|u.$HDHu2H$HD2HT$8H E3LLH~IMIH;tAAH;|H;Lu*THLՐHtHDHD2HT$8D߰HLJHHFH\$0Ht$@H _HHXHhHpHx AVH HZH3Ls3H93~IHt8IH;|Hǁr˰H\$0Hl$8Ht$@H|$HH A^2H\$WH0Ha0IDL$ HE3u6H\$`AE3HHH@ H H8i2H{0H\$@H0_H(L$0хu'HL$8HD$8T$<EиDЉT$0LD$0E3AAIcɋIЉT$0Hr݅tH(HAH\$UHl$H3HMHգE HELEHEH]KE0E3HEH]H]]H]]'H]/H]7]?H]G]OH\$ H$Hİ]@SH0D3ۋHHf9uHDfEuUAD$(LHL$ H"AI`H0[̃I̋Qu3HIHH@HH%@SH AHHIHH@ 9CrKHKSHH@HH [H%`@SH AHكuHIHH@ .ȉCȉAHKSHH@HH [H%H\$WH H(t HtH>HH\$0H _@SH HHHHK8?H|HH [LI[IkIs WATAUAVAWHPIcHdICMHMICLd$HHKMMMH$H$;u8$u H!GrAȄu_I͉$IEH@G DHDL`D$HGHuHP I$AE\IH@PHtE3HD$@Dt$HA_HO`E3̌DUPE_DD vDLE0A u.ABAHB Dt AuA@ A;U3-HH艃y3퉫@HHL$@蝟L\$p@I[0Ik8Is@IA_A^A]A\_H\$WH 3HwHA8HH3HA@HyyHDG HyPHyXHHQHAHyfyy@y Hy0HypHy`Hy(HnHÉ@HH\$0H _H\$WH H(t HtHnHH\$0H _@SH 3H-yHHHDB nm3HˉHH [LI[IkIs ISWATAUAVAWHp3HsvICHHMICHWt$P~ 3DHMD$Xl@HMM IIH@AфuD$L$$uyHL$@蜝tY|$0HT$@Dd$(MMLl$ Ht4Ht(3҃@3tf$3HDB k3O3@H$MωD$0MDd$(HLl$ u2A L3Hk@@HHL$@oL\$p@I[0Ik@IsHIA_A^A]A\_@SH Hb{ tHK0HCHtHHtHI3HtmfAfAAAAfAA;} ƃ2H [HHXHhHxLp AWMLMtAy tLY0HAHtLMtM[E3MHHt&;rJLBzISZL„tHzuzt<JzÃAI+HH;~,MtAuA3H\$Hl$H|$ Lt$(A_À|uAA;stELIII+HI;wAxtA@uA8@tAHAxI+ËII;ZA@B|\;rAIMtA>H:@SH 38Y tHQ0HAHtHHtHRHHt\ffBBBBfBBBtH [@SH IT3HA0HHA8APHA@HAHHAHAHA A(HXnHtHH [HHXHhHpHx AVH0ITE3Lq0HLq8IDqPILq@HLqHIIH@ЅuKT2Ls0Ls8DsPLs@LsHDD$hADC8A E;sCP E;$CPCP:u%C<C@CDCHCLF<u"DKzHM EIEAIH@pHEHE*H8@ $<?A;HMC :EG DGfEGEGEGEHEE f9t DHA rHUHM yt_HUI|tOG $<u@Äu;DD+HBtI2y@H.tIyy@HM@HMH3^MH$HĠA_A^A]A\_^]@SH HaH>XHHtHH [H\$H|$ UHl$HHNH3HEGHxHHeH SeHHeHSeHeeHeeHMHEHMHEHuHHH@nB $<EB}fEB HUEEDEHMEwu2MDIIcEx$LED;sA@f u AHyAHUE3HvfHHEHU}DEHMEu]HUH|IHMHM~HMGH3DJL$I[ I{(I]H\$Ht$ UWAUAVAWHl$HHsH3HE'HeHQeHHeLeHEHzHMHIHE׊A $<LMD$ (HyH>HEHHǀ<8uA A;ItHND+ߺ EHNHNHUDMHF8urt HBfA.fA;u#;uyyfAySt IEfA;uC;v IEPfA;u*u%y|yfAtyA tE3t#D;s IEBxfA;tDD;rEHME3IsLMD$ (HM)xHHHEHH<uA ED+HMHAVLD;EGAD;A;Us IED HAfA.t;r;rLD;sdAHMIIru,LMD$ HMmwHtHEHǀ<8uA;v2DD+HMEHȺ KEHUHJEfAE A HB8uHM{HM'H3FL$I[@IsHIA_A^A]_]@SHPH7H3HD$@HHL$ dHT$(HL$ )hHT$0HL$(!fD$:DD$0L$6fA<+fAfD D$2ff L$8fAfD D$4ff HCfHHCfD@HL$@H31FHP[@SHPH~H3HD$@HHL$ acHT$(HL$ ygHT$0HL$(qeD$:DD$0L$6fA<+fAfD D$2ff L$8fAfD D$4ff HCfHHCfD@HL$@H3EHP[@SHPH}H3HD$@HHL$ bHT$(HL$ fHT$0HL$(dT$0HCfD$0HD$(AH>l<HHD$ EA6DAE L}t$<u @8}AtEߋUINHI^0DHHH@bDED@8}IN0@8u;su2HAE3 HH@ ybHfH5} u EfAEEIfAEEeIH@(8bteHIMtVHAE3:HH@ bDMHmEH4@8}tMtIIHa@HMbuL$@I[0Is8I{@IA_A^A]A\]LI[IkIsWH@HY`HPICHH;ICHuHYXH3H3H@BaHD$0D$8*Ht=}8t58t @ t$<uMHHH@aHD$0D$8*HuHseHcj@H\$P@Hl$XHt$`H@_HHL$ HLH HPHHUSVWATAUAVAWHhHLqXHE3HEHWHEH`LHELHHEH]߉]H]]]EMtALq`A DjHEMLIEH9]HEgHEHEEHEEt#A;s IBHf\tA;rA;uAE; DIBpf\tA;rDHME+I.hHM[HUIlHMHADaHA uDp@AD DpEA;(Mu(-Ht HLLMHMgrHMWHUgLDt$(HAHLA0IHD$ EIOHH@^DA;s'H]_;ss HCpf\tA;r3HU_HMDE+gtWHMZHUIFHMHADaHA uDp@AD DpEtfZWHMoHt.MtHEwL9Ht@@8;HEWH@XHHEwHt'#MtIIH] ߋߋDHMAqHM(pAHĸA_A^A]A\_^[]H\$WH H3HI00~ ~ twDfuD$PuAEAPDAA8`u8qHH@\3Ҹ`HO0HT$0HH@(\H9qHO0HH@\3ҸHHO0HHHB(HT$0\ H9QLʊF9QhuDAt AtA t AHD 9QhuH\$8H _DA3LEt]AA;s IBD PEfA r@A;s IBD PEAɍAރ;wHI7?Ir|t A;r2H\$UHH3HwFHEHtGHEHHEHUHUHUHUfUHUHUHUHEFHM/-H$HĀ]H\$UHH3HEHEHFHEHHEHUHUHUHUfUHUHUHUHE>=HM,H$HĀ]3HJHHmHHAHbFHAHHHAPHQXHQ`HQhHAH&HQ fQ(Q,Q0HQ@HHQpHQ8HAHH\$WH H(t HtH>HH\$0H _@SH HIHHHHBHH [LI[IsI{AVH@D$xHd$0IكMHD$(HD$pICu2=uII΋_,H@YtH\$PHt$XH|$`H@A^̋HHH@ H%X3;}+8A0tHA@HI Ht H HtHAHcHHHH\$WH Ht HtHHH\$0H _H\$Hl$Ht$WH Hy3HHt@f;is!HHHtHWBfHBHB f B BfBBfBfBJfBfBfB B $B$(B(f,B*f.B,0B0f4B2f6ftKB$8B%9B&:B'<B+@B3fHB5JHB6IB@8BA9BB:BC<BG@BOfHBQJHBRHK:t:zD8LgPHLMIX3f;u(IIH@jQHHHA<$u?3ۈ`A9$u @;fu$=s ƇA<$HDA<$f;v HHO0HH@P3ҽ@ȋ ;vHO0HHBP3ҋȉI_dtDD(>I;dtEMMHt$ IHtHHA7 HAE3HH@ PHTH"HB2H\$`Hl$hHt$pH0A_A^A]A\_H\$Hl$Ht$WAVAWH@LAHE3LAA@fI@HA@ f A@ A@fA@A@fA@fA@AHfA@fA@fA@ A@ $A@$(A@(f,A@*f.A@,0A@0f4A@2f6ftRA@$8A@%9A@&:A@'<A@+@A@3fHA@5JI@6PA@@8A@A9A@B:A@C<A@G@A@OfHA@QJI@RHKA8tA8AxD8LCPHHHH͉aHKHHtHHMXL{H蔸LHt@H AAJTLxLxLx Dx(H;IIJMz0Mz8EzPMz@MzHMLSHMtHHD$(HMΉ|$ LIu9HKHHtHHLL{H2H\$`Hl$hHt$pH@A_A^_HHH@LuYfu(MHKHLʼnD$(H։|$ HrHHH@lLZsH\$Hl$Ht$WAVAWH 3MLHfu$@HO0HH@LDЊu+3ҋDD@AAD;vf9uADAEt^t2(3AA;vlDEA_C3A;vDDEA83C@A;vAʸDAH\$@AHt$PEA/Hl$HH A_A^_HHXHhHpHx ATAVAWHPyPLHu2ŵ3Ht H"HHF`HHI0H?HD$03H(HD$8H\$@\$HHH@]JKHD^HHt?H<HH)0HGH֑HGH+H_ H_(H_0_8HG_@HH~XHu:H=IAE3IH@ IHVNInDfEu3AAPA׋͉T$HAL~0EHNHL$@_@MtMIIH@QIȅt7Dg@MADAD$HOHT$0D$ Ae_@AIE3IH@ HHpMIH;2L\$PI[ Ik(Is0I{8IA_A^A\H\$T$HL$UVWATAUAVAWH0DA3AAEHD=v L$A@ADNu(uE;vAwAH A;233۸DAAiAD;$DK Dt$xD;ADB3A3ҍD3AD3AAAHE0D+⋨0G, E͉t$(DAAD3ҋˍҺH$MAōM;wǩ?tDDHl$pL$DdAvIA:A=wA>A6A;,33۸?DAAiAD;fu3A+HE0DH$D0DL$(DDAAD3ҋAEȉMNANA;wǩtEAHl$pL$DdAvA8A>uEH$AH3A>uHE08qu)Ar H$H0A_A^A]A\_^]3ۅufu3A+HE0DH$D0DΉ\$(DAAD3AHIAA#E FAFA;wtEAHl$pL$DdAA>AHHXHhHpHx ATAUAVAWDҋ3ҋA3E+ADDD$PD[EtE+t E;uA[  3ҋDDED3ҋAA;vE3AϋAwEEAAD;sAB3AD+EE3AwAAAAȋAD;sHAu=3A3ҋAA;w DAD+DD+Av3ABAtDA&t3ˋDDAD+ADEYAH\$(Hl$0Ht$8H|$@A_A^A]A\HHXHhDH VWAVH@AD$LD@ AEtEHMHeE3:>EHMHCH3HH@0>E3;uA7HG00~$~~ p fEt^D;s6D$HHD$0DHD$PAHD$(HH\$ BE3t uE3E3D8D$TtA;uHM>HL$0y>HM ?L$I[8Is@I{HIA_A^A]A\]HHXHhHpHx AVH0HHHI0HH@+;rHK0HH@n+HK0HHB[+HKp*?DHSpLC0HHt$ HK3D {PAHC8HKEJ|7AHI@ A H0I0@@A@HPIP@`A`IHpIIHuHS8IDLCHAJAHB A@ J0AH0B@A@@JPAHPB`A@`MJpIAHHuLC8WHKWAD HS8ALCHAJAHB A@ J0AH0B@A@@JPAHPB`A@`MJpIAHIuJHI@ A H0I0@@A@HPIP@`A`IHpIIIu HKffA HKA HKfAHKAHKfAHKfAHKAHKfAHKfAHKfAHK AHK$A HKti8A$9HKA%:HKA&<HKA'HK@A+HfA3JA5HKHKHA6(A$,HKfA(.HKfA*0HKA,4HKfA06HKfA28HKA@9HKAA:HKAB<HKACHK@AGHfAOJAQHKHKHARHKHKfAHKHHA{PuHS HD H%Eu /HAE3HH@ 'H+H2H\$@Hl$HHt$PH|$XH0A^HHXHhHpHx AVH@:I,(DH<v3<؄uHI0HH@&HO0HH@r&DH<DHHH#AHD$0GPfD$(D$ H\$PHl$XHt$`H|$hH@A^@SH@AHHAHMMHcIH;~ 3H=`E@ICDAJHD$0fT$(HӉL$ 3H@[H\$LL$ UVWATAUAVAWHl$HH;H3HELeHb 3HEHlLLcH4HMHEH}}H}ω}H}H}}}.u0IDOE3IH@ $H|)IUoHugBHcHHH u @}vEAMHH+f}wuHHELHD$(LMHEHLEHD$ LWH*HyXUHEWH*HyX <^L3HMZfI~S,IUDE3IH@ $LEIH#3EIHƀ}tHL,eI DIDE3IH@ #EL2AHMA+HMEEHULEH3IAWI*MyXBHEWH*HyX )^L2IHMZfI~B+IDˋUE3IH@  #LEIH2IDE3IH@ "DL1IHM*HMHU߾ DLEH52IAIDE3IH@ "DL1IHM*HMHUDTLEH1IIDE3IH@ ,"H&IIDE3IH@ "Mwtt u#DFAA Hi1IqMt\IDE3IH@ !H-&IEIDE3 IH@ !E $H1ED$IHM3HMH37H$HİA_A^A]A\_^]DT$(LEt$AtAuqAA+DA+fDQA+AD RAt$AAHAAB$BAGAAHADA$ AAE HHXHpHxUATAUAVAWHhHHn IHELMHhLEHE3H}HEWHiHHELHEH}HD$(HEHD$ E'dEۋЃt"uH /D$0u5HAE3HH@ LH&H`LmMAE tF$<t@ADuDINHI^0躟DHHH@kDADEeH|$(LEE3@|$ HUDeIHuAH .D$0HD$(AH(<HHD$ EAlDAE L}t$<u @8}AtEߋUINHI^0DHHH@DED@8}IN0@8u;Suu2HAE3 HH@ YH"H} u EfAEEIfAEEeIH@(teHI tVHAE3:HH@ DMH)EHu@8}tMtIIH@HMB1L$@I[0Is8I{@IA_A^A]A\]H\$UVWATAUAVAWHl$H3H;HEWHdHHEHH,H]HEHgHEE]H]߉]99G(w LG0HWpLˉD$ HM8tHMs9tHUBfHBHB f B BfBBfBfBJfBfBfB B $B$(B(f,B*f.B,0B0f4B2f6ftKB$8B%9B&:B'<B+@B3fHB5JHB6IB@8BA9BB:BC<BG@BOfHBQJHBRHOHHKH7E3AHHH@ uQf;u D(DHGH3@ +HAH"D@t! H=HUH9_`PH9_h(蟅HH {XHH bHHHXHX HO0HH@TʉUwDLgf;u D(D]8WE]DӃPD}uLe IHE߹XLHt?ANTHXHXHX X(H4IHbIFI^0I^8A^PI^@I^HLMdHUDMwILG0\$(D$ ƕI6upHAE3HH@ @f;u(AF +3H)!HD@IIHLMu&MUDmwAMU;LwHH9_H HHGhHkHw,0LLG0HWhHO`D$(HGHHD$ ܾaHOXHtHHH@=HAE3HH@ LD"HH"'RHWBfHBHB f B BfBBfBfBJfBfBfB B $B$(B(f,B*f.B,0B0f4B2f6ftKB$8B%9B&:B'<B+@B3fHB5JHB6IB@8BA9BB:BC<BG@BOfHBQJHBRHKH9_HH9_`u9G(HO0DHH@JDf;u(AAAȉUHOHM߹XLHt?H ^AJTHXHXHX X(HVIIJIZ0IZ8AZPIZ@IZHLLWHMf;u(LG0HUωD$(E΋IʉD$ ՑtMPH9_huj(oHt"H OXHH z]HHHXHX HHGhHu-HE3HH@ EHHHYHOh(u HB0LLG0HWhHO`D$(HGHHD$ =tHO`HHH@H$HĐA_A^A]A\_^]H\$ HT$UVWATAUAVAWHH3HHyPWHEHH[HHEH5 HEH^HEEH]]H]]t HOf9fA HOA HOfAHOAHOfAHOfAHOAHOfAHOfAHOfAHO AHO$A HOti8A$9HOA%:HOA&<HOA'HO@A+HfA3JA5HOHKHA6(A$,HOfA(.HOfA*0HOA,4HOfA06HOfA28HOA@9HOAA:HOAB<HOACHO@AGHfAOJAQHOHKHARHOHOfAHOHHAH/AH9_HH9_Xu H9_` HOf9fA HOA HOfAHOAHOfAHOfAHOAHOfAHOfAHOfAHO AHO$A HOti8A$9HOA%:HOA&<HOA'HO@A+HfA3JA5HOHKHA6(A$,HOfA(.HOfA*0HOA,4HOfA06HOfA28HOA@9HOAA:HOAB<HOACHO@AGHfAOJAQHOHKHARHWpHOLˈHOfAHOHHAHMЋLG0D$ +jHM-YHOXHu`HO`HHH@ JHOHN-HO0DEEHH@SDf;uD(HHH@(DAD8vpHGHD;` tIH@HULG0HMEHEuD|$ *tHM,EDEDED;rHuHHE3AHH@ Eu k uHH H$HĀA_A^A]A\_^]ú PuHO0HH@#Df;u D(DEEDD8AG$AHMPHOHULG0HMHMEDmDt$ )t HM+u@AHMPED;r@HuHu-HAE3 HH@ b HHHO`HHHH@ 5 HAE3HH@  HH@SH HHIHHtHH HcHHKXHtHH HcXHK`HtHH Hc`HKhHtHHt Hchdƃƃ`H [HHXHhHpHx ATAVAWH 3HH9yHtHI0HtvHH@ tef;u(DDDLc@8v0DHSH;r tHRAIE8E;rӰ2H\$@Hl$HHt$PH|$XH A_A^A\@SH 3Hf;u(?HI0HH@, 3H [HHXDH L@HPUVWATAUAVAWHhHHR3HHD$HWHEHXSH LHMHHEHL$@HT$@I؉|$PD$XHUω}fEH}f}}@}H}H}H}H},u n@;AE؄uHN0HH@ D˸HNH3AADEEDDDtfHE_AL^HA+D;EIˋABuLF0HT$@\$0HMD$(LL\$ vHMRyt EE;rDLu_DAEL}AHFHHT$@LF0HMD\$0LΉ\$(HD$ uQLFHAA@P< u4MH0 [ABHAB t <I@0uH A;PHEH{HD$hHWAHD$pLuLuLuLuLuLufDuDuLt$xDufDuLuEHtD2MtE0MtE1HHtH3H@IO0A_zHH@IGpHD$XDh@HX0|$PEyEAAA0Dh@IO0EHD$XHH@AWzAAЍR3HcHHHEy AA4IGpIO0HD$XDh@HEH@+AWzAALL$X RAA0D$P+IY8D$`Ey AA9IGpIO0HD$XDh@HEH@AWzALL$XAЍR3t$PDIHEy AAA1IGpIO0HD$XHH@sLL$XAA@AGzEa8@Dd$PD+|$`DDd$PHMMopE8u@}AM@#IO0HH@AWzAE@AOzLIE(MG0|$@Lt$8T$0HUHD$(L$ HM\iHMrXE3HME33]tLH/LIW0HL$hM٪YH|$xMte?`u`AD8w uZGA:tRwIA:tDWHt;DGIA0IAE3IA?puND8w uHOv@WAA:tG;s.EA:tEDGGA+;rA:t r OHu%E3HME3IWsLHt-AHUpHtALExMtA A:vH;t5Dd$PH;t)HAAAADq HEhHtAHL$h\HMHMjXH$`AH A_A^A]A\_^]HHXDH L@fPUVWATAUAVAWHhH3HHEWH;LHI0DHEwHh}HEH9HEH_HD$PH;<HD$XEHfEH}H}H@H}H}H}H}f}@uH|$`|$hf|$lH|$pLewMtA<$IFpHX0@8x@}H@DA'IN0HH@EFzIFpH@DC@EwnM~pA8@} AO@#IN0HH@xAVzAG@ANzLDEwIG(DD$@MF0H|$8T$0HUHD$(L$ HMX5HM o$E3HME33pLHIV0HL$PMOHL$`9puS@8y uMQvEDAD:tA;s3DD:DIAA+;rD:ty r DiLuE3HME3I8pLHlMteEWHMffA!E rotU@8}t)IFpH;X8tHX8HM .vHE_Ht LEoHȊUg @ MtA4$@HL$P@HMwHMNUH$@@HA_A^A]A\_^]H\$Hl$Ht$WH0DY@EIH@iDAAI @H; A;IDLfA;sfA9tEu5@A BfAAr AE3IfDfE;Ht1HHt%ET$(iDD$ LEBAAD@@H\$@Hl$HHt$PH0_H\$DQLuyYuoDIAI AH;w[ A;uNfCtfC9tfA;s2MXMf HcBDfAM[CfBDfA;rH\$DA@HQB3Eu2f: rD AAރ:wHI!5IrA|tHA;rʰHHXHhHpHx DI@HyB3EA E2DB3EtwHf> /7")~B,.u4EuAE+DA+Aƃ#wHH?HrU|tPAHA;rEuEtE;tE2A/Aw'ABfAHL$P螙HMHMIL$@I[0Is8I{@IA_A^A]A\]H\$UHH3HHEHHEH+HEH*UHUHUHUfUHUHUHUHEHM菴H$HĀ]̰AxLHQpfB AzHQpB A|HQpfBA~HQpBHIpAfAAIHpfAAIHpAAIHpfAAIHpfAAIHpfAAIHpAAIHpA I@H\$UHH3HwHEHtHEH)HEH)HEHUHUHUH@pHUfUHUHUHU6HM'H$HĀ]@SH HHHtHHHHHtHHHH`?H PHx ?H ?H ?HH H H`H0 H H H H Hp H@ H HxeOH)?Hx?H?Hx5OH>Hx>HOHK`H [OH\$WH HHHHHgHtHKHH\$0H _H\$Hl$Ht$AVH HH`MHML|'H-HxHxLE3LHLLphMHHxLLpHxLLHLLpML HsH H uD( L0 D8 H%H LP DX H@ HH L` Dh L D Hp Hx L D L D H H L D L D H H L D L D H H L D( L@ DH H0 H8 LP DX H L D H H L D L L L$H5QH H L( L0 L8 ǃ@ H L Lh Hx L L L ǃ (KH`H(Lh3LpALxǃLH LP Lx L Lh L L L L L L D L L L L L LsPLsXǃp L ^H(L3L1LLLǃ*Hl$8HHt$@fD4L8DLfǃ!DLDLDD H\$0H A^@SH HNHHHHxI3HHH%HHHHHH(H804HPH"HXH`HhHpHxHV%HH0$HHHHHHCHHHHH [H\$WH H(t HtH.FHH\$0H _H\$Ht$WH 3H<HH=HHHHHH@HHHHxHPHxHHHH(H8@04HaHH5HH\$0Ht$8H _^HHhHpLH PWATAUAVAWH0H$IL$HLLHHHuHHIIH@_D$LPIA&D$Hx3E3LBIԉD$(Dt$ bHHH@HHLL$xLHJHxHJH$HJ(H$HJ@L$hJ;Cvs+HT$ fE3fD$ fD$"HCH xHL$(HL$ )x;{rH\$@Ht$HH0_HKHo5Hc`HHXHpHxLp AWH 3ۋAMLu Eu AAA;uLIM蠫;DBօtILT$PEG _E;Js IBAD HC ^A;Js IB HA+uOAD;r+u&8\$XttM+C 7A+u'I;r3H\$0Ht$8H|$@Lt$HH A_Ë3HKHHYHA HHA(H;HQ0Q8HQ@QHHA3QfQPQSHQXHQ`HQhHQpHAxHfH\$WH H(t HtH.4HH\$0H _@SH HHH HK HHH [H\$WH 3HىyfyP@ySHyXHy`HIhHt 3H{hHKpHtHH.H{p@3HCxfH\$0H _HHXHhHpHx AVH IAHH^Dt$hH{sfDtDHHH@=w#= u=@u =u2CS|$P1HChHu H2UHT$`HK HtbAE3tHtHKhLH輨L$XKH{XH{`fDsPfǃCRH\$0Hl$8Ht$@H|$HH A^Hk^H\$Hl$VWAVH IAHH9E3L9w uuAN0Hks0Ht'H Lp HH HHLp(DpLpIHCpHt-HHutHT$xHK Ht-AE3u+H2H\$@Hl$HH A^_^HHL$`HD$hLshDHKXHC`H;wHT$XH%HH9CXwD$pCfDsPCRƃHHXHhHpHx AVH@IALH HF38Xt H9XQo@LwHFOHFH fOPHF@8hu@"HW GSHΈϗHF8Xus@HGXHF@8hu@/HGhHHHFD@8ht2PD@H^HGXHG`_RHF@8hXHԹ0.HHt&HHZ HH HBHZ(ZHZHHWpHtCHF@8hu HїÄt)LO`H\$ HWXHLD$0@oR@ H2H\$PHl$XHt$`H|$hH@A^H\$UVWATAUAVAWHl$HE3HΧH5ǶHEWHA MHELH LHEALeDeLeDeHuEDeLeL9ahHBD8`9AHUIHEIU0H+DA+u HEuIFY8XuHUI腖H}AĄcM9'uR0,Ht H  HHH0L` L`(D`L`IIH IUpH  AtFHEgLMHD$ LEHMLMgLEHUI;rAt?HEgLMHD$ LEHMtLLMgLEHUIMpt3;rIFIMEpPtHHI;H IAHEgLMHD$ LEHM;t&ILEgHUHI[;rIIMpAHMHMH$HĠA_A^A]A\_^]H@I@ IND8auIHIIHH INMEpQuHHAHI;@(~uHHAHI@(IFD8`uHHHHIHH(XHHXHpHx UAVAWHhH H H3HE3H2HELH WHIHEHHD$XH HD$`H]HD$x\$pH\$hH@YAI9_psHMXDHL$XPA3ҍHMD!3IOpHD$PLL$@HD$ LD$H_Lt$@ItLHt$PHMLI"u=LHMIUHT$HHL$XLMNj{HH~I>AHM|"uHH;|IGHt2HHt&EOI>H+LHt$(iHD$ -H~HT$HHL$XLMIOpHT$XAƇHT$@IAjHI9GXvmIGHtHHHtWHD$PHLH HD$XH9DfHELHEHEHt$`t$hft$lHt$pHME@uHuHME@uHuHME@uHu@u`I9vhtAA#ĄuAVMF E3ILEpI9u0u/A~u%A9v8uII AwE}@A ff9%A;vDD+A)$HD$xHH;I9vhI^HL$PoAIN ENEFXIVhD$0AFPfD$(HL$ HL$PH|$`D|$h@t$lH\$p\pt)IEHT$PE3IH@(@H$I9vhtAA#ĄuHUpHtIIH@ QtAOfAFPtAF8#IVp+ȉMxHM7؄)@ƄI^HL$PnUxLMLEH|$`HMD|$h@t$lH\$p8I^HUIHHHHBANSIV AFMNXLD$HAFfL$@ANPfL$8HL$PHT$0HUD$(IF`HD$ Mpt IEHT$PE3IH@(<A܄u@HEH9EuAĈE`+t!HUHM+tH|$xA܊E`E`@H|$xHA=# DA@HM HM HM HL$PmH$hH A_A^A]A\_^]HT$USVWATAUAVAWHl$H3HWHELHIHEH6HEHcHEfEH]]H]]H]]]EH9Yhu D{]yX0} u}Ht&H ީHX HH HHHX(XHXHIFpHLHH INhHt !I^hAI^hE~REHt&H aHX HH {HHHX(XHXHIFpHlLHHL VINHH@ 3AȋANMwDtE]gDmAEHMoLMEHD+A;DBE +uE; uINpH}LE HMeAFHUMFHMDd$(LωD$ 贘t}HMAEw3DٖUgUwEHM+;BIVhD謖HMt8}guA}gA;$INhHt P I^hI^hE~REM9~prHHDH@H]o}_I9^`w D3IrHEA+02HI9N`sE~`DD+3AE+I:DoAFD#EEtLHMH}HLMHHINpHHHILEHH؋AF+( aHEHH u v EDE_AAA+D;GH}uD3I蓑3Ic^H]H؋ADEujAA;u_INMEHHLHHH@2HM$H$HA_A^A]A\_^]HMFtDE_B/3LAHA@#HMAMFHUD$ KtHMtAIHUD蘐H]oE3HMLEHLH]oD+i HEH?ENL׽iH|$ H́H\$UVWAVAWH0A3HHHH9YhH;yXHOyXHIHHBfFHHHLHGHHHHH9^pL;AHNpLL$xLD$`IH|$xI>H;~HI+FHT$`HHI;IOHT$`HtHFHLI@0DtNHHHLL;vH\$hH0A_A^_^]HFHtHHtDNL~iLt$ wLI[ISWH`H5HICIKH[WICA؃d$@D$Ht4E3HL$0Ht LD$xH$HL$ DHH HL$0kH\$pH`_HHXDH L@HHUVWATAUAVAWHhH3EW}LHT$@H]H}HEKHLHEHUH@}HEDHgHEHAEEHHMIZH9s I$IHUgLEIH@(t>I\$`HEgH;s]HH+HH uDID$`IE3Hu.I\$`@HM?H$(HA_A^A]A\_^]HEgI9|$htQMIL$hIHMgIHMgI9L$`sIL$`I9L$XsIL$XE;tA$HEwE+D0yI9|$pkIL$EDt$4HH@HMgLAT$t$8F#UHD$HEtDDLEHHILELHHAAL$ILMILD+IL$pLutqHEHH u v DD$4ADMHuAT$H+D;DGDD$0HH9}AIA@3A#HMAD]HMWHULϋALAHM߉D$ 6LE3HMrLM~hHMLMLILmWLHuILIMp-IcEHMHHE\LLLM;|LeWDD$0LuA$DL$83ALMct$LLAAHT$@DHD$Hu AAA;t{AIAA3#HMADػ=MD$HUMD|$ HMHMq t$0L$HDHMHT$@0HUt$0IL$LAEIHHHHH@ cD|$4HMgD+LEHD$@Hȋt$8D|$4DHMg|$HEUDuoHEH_EL$LiL|$ H{-t HH;|@2HM7H$@HİA_A^A]A\_^]HLH L@HPUVWATAUAVAWHhHHpLHeH 9HeWHMIpHEEEHMHEEEE3HM3IWpHMH}_E3HLmoEfD8utEHUWHUHIOpLMLEiHULI8RH}_HH}gLMHL3AGHMOMOLH}HLl$0HL$(HωD$ Z}OuCHMgLHYHUWHMILLH}_LHI+H;HL(H}_%}wI;H}_HHH+HHL;2HUWIOpLHII\HE3p t@HELMHD$ LEHMt)LMLEHUIOptA;rEIOpHUJE2HMvHMmAHA_A^A]A\_^]@USVWAVHH@B9AJB9A>HA0LB0L+DFE+u HEuEBPf9APBR8ARHBXH9AXHB`H9A`8Hyht$HRhHDAXHIh{HypHrpHGDp HFD;p HF H9G uxHF(H9G(un3EtcHELMHHD$ LE8HdtHHELM@HD$ LE0HEt)HE0H9E8uHE@H9EHuHEH9Eu A;r2H@A^_^[]H\$LD$UVWATAUAVAWH$`HHLZL ;3HE8WHELHEH0ILT$XLLL$`E~@HH >A DfH|$hf9|$p%f|$tH|$xLEHM}HU0@}HH}@HU@}H}HU@}H}@LE`HMh}pLULMH}}f}H}EEPE EExA;vDD+HM@E3HMAeHH9~hH^HL$XMHEHN DNDFXHVhHD$hD$0FPfD$(HL$ HL$XD|$p@|$tH\$xNt|IHT$XE3IH@(@DHM MHM`BHMHMHM0HMHL$XLH$AHĠA_A^A]A\_^]H9~htuHH{HHHH@ #`EgfFPtDF8#D+ljD$Tt_lH@LM`HD$ LEI<@8ƅH^HL$XLHEHD$hIFD|$p@|$tH\$xP+PHNpLMHLEHHH^ jNS|$HfL$@NPfL$8H\$0NHULNXLL$(HN`HL$ HL$XMrIHT$XE3IH@(”HEH9EHUHM0/H^HL$XKHELMLEHD$hAD|$pHM0@|$tH\$xHHNS|$HfL$@NPfL$8HN HL$0HEHD$0LHD$PAHD$(IHD$QHD$ _t@8|$Pu3@8t*@8|$Q< 릋VLF E3IݞtED$THDEtIHUE3IH@(xt)A@DVLF E3I{u EEIHUE3IH@( cH\$Hl$HT$VWATAVAWH0iXLAA;AG3HHu2bDtOHD$hEƋHD$ A+HA;IAGDtG9t$huA˅tH8uH;rED;rHH\$`Hl$pH0A_A^A\_^HvH\$Hl$VWAVH HIHILHH@InHDIH~hHtI&HF`H`HNpHtUH?tHHIHH|$@u+HHNpLLD$@HuH'HcHIHHcHH2H\$HHl$PH A^_^KH(HLHH0!HH ~I3IIIxIHIIpIAIIQAQIQ IQ(IQpAQhIQ`fAxH(H\$WH H(t HtHHH\$0H _@SH HHH4HHKxHK0B"HWyHH [@SH HaHكaHI Ht Hc Hc(HcpH [H\$Ht$HT$WH IAHHD$8HH L$PKhL$XzHC@sH{`t;GȃKHC HtrSH{0HL tYDCHϋSAD+€{t-"v!HKxt1Ht!H{|DC3H! H2H\$0Ht$@H _H\$Ht$WH@HIQHH9WXtHHH@(ǎtWHHL$PDKE3HS Ht$(H@8HL$ Ht)C9D$Pu HKx@tHu@2fx@H\$XHt$`H@_H\$ UVWATAUAVAWHl$HHuH3HEzH{HEHHv3HJMHELH]LD$hHH@DDH9uH9pu8xu 8yD$PHMNA;8x8yLL$@3LD$XHNxHL$@HEHD$XHHHL$@HHHIHD$`LHyHHIFHHMHIIHD$HI+L,LL$@LD$XHNxLHL$@HuL3ILL$@LD$X%HL$@HEHD$XHHHL$@HHHIHD$`LHyHHIFHHMHIIHD$HI+LLL$@LD$XIHL$@HuL|$hHNx|IHh5VfxI9UXtIEMIH@(Ћ LL$H3LD$`DHM(H|$HHLd$hT$`NAA;v+ʋIMDDHV Ld$(IHA8HL$pHL$ IV9|$pALL$HALD$`HMH|$HHuH9uH9pu8xu8yt>D$Pt9L|$hCAH\$`3HMAAHDLD$HztHMHMH3hH$hHA_A^A]A\_^]H\$H|$HxHJH;A>Et5DYDDHYPAڋyHI#DȋHDrAA;rܰ2H\$H|$H\$H|$HxHJH;A>Et5DYDDHYPAڋyHI#DȋHDsAA;rܰ2H\$H|$HHXLH L@HPUVWATAUAVAWHHLHL$ oaE3L9Xu IG(HXH`HXIGH;~HH+HHXH`H  ExH`DXAI;wLNjIlEIO`HEGhAAIG`H`y?tt pzLHIIGp`HtRPHL$ Ht0LHL$ HXetE3HL$ If `DH`IO`AH+HIcWhE3LLH EL`HI H`EIGpHHXHPStH HH\$0H _HHXHpL@UWATAVAWHhH HMHMLH}H NuHL$XW3HD$`HΈ\$pE3H\$hID$xXHNH~;wH;rVuA9rEv A@9A.AHT$hHL$X [uiLIHZYA9sM@ƋE3AEH@IBQ@HBHD$xD$(HD$ ŮA;EIDBZu+݋H\$PHl$`H0A^_^3HkHHEeHHGHHHHAHHQHQQ HQ(HQhHQ0HQ@HQ8HQXHQHQPQpHQxHHHH\$WH H(t HtHHH\$0H _@SH HjHH$H|H_HH [H\$Ht$WH 3HHyHyHy(HyhwHI0HtHHvHK@H{0HtHHvHK8H{@HtHHtvHKXH{8HtHHYvHKHH{XHtHH>vHH{H{pH{xHtHHvHHHt eHHHtHt$8HH\$0H _H\$WH HQHHB HH;tNHHpBHt.HK(Ht Hc(HK HtHc HHOHA HH;uHHtH'H_Ht.HK(Ht Hc(HK HtHc HuHgHhH\$0HH _H\$DD$HT$UVWATAUAVAWHl$H`HMHL$@NHMEHLLD$0LHT$@ILd$ AJr3ۄK0xHHt&HjH^HH_HFH^^(H^ HHw8HDH{`|$\HEHH A;ƉF^(DGADvHFHkDNHL$4HL$ LHL$@HEF9D$48HLLF HW8HGGHBH OHBHO Lo(LGh0[Ht%H CXHXHH HHXHX X(HHGXHAHT$`E3H{HW8E3MHBO`HB֋HOdInANHt HAHHG0H6DLd$ LD$0HIOpHG03ҹ@Xw oHt HHHG@HHֈ\$(E3ɉ\$ EHALd$ LD$0IHUoHw@HD$4LHD$ HMDNHV ttF9D$4ukO _pHHtNHyt8AG0D$4IG0H fD$8IGHfL$:HD$4HH]HuDHM蝩HL$@蓩H$AH`A_A^A]A\_^]HHXHhHpHx ATAVAWH@AIDH $AH$L$HC(Hs{ L{hkA;PHHH@pH$͋;AB33A0CHt\AHt%H mUHhHH HHhHh h(HHCXHAE3HHx$ỈsdDs`Hk0Hk@LHt'H HfIIJIjIjAj(Ij LLS8Mtb$MωD$0DƋCA։|$(IʉD$ =\t7HωkpHHtHJt Hz2H\$`Hl$hHt$pH|$xH@A_A^A\LI[UHHpHeHu\eE3HeHEHnHEHEICHEICHEICtHEгHHE0HHE8H}HE82ۈHMHtLInHMH$Hp]LI[WH`H$H[IC3HICICICH$ICI[I{\$XtH$H$HˆHL$@{H\$pH`_H\$Hl$LL$ VWATAVAWH LM^f#E3HHtNL3H8PHD$hHOLHIf_fw fDg PE3AHI+HϊH\$PHl$XH A_A^A\_^LI[UVWAVAWHH`3HvZHEH]@HwMHEAAH}IEى}LBHELR EICAHE8LICHEHICt@tHM8HtXHHEHEHHtGHu8IHuLI"@+MHD$ LEHw%H@HHXlHMH$@H`A_A^_^]LI[I{UHHpHeHiYHeHeHEHbHEHEICHEICHEICu%HMHtHHkH}@3H]LMHULHA@HtHHH}kHML\$p@I[I{I]H\$Ht$H|$ UATAUAVAWHl$H`HLHL$@踢HM询3ADH9HOHH@jHDDoHQHJ H1H;tpDO LF(HVHO0Dl$ StUHH}7HN(Ht H^(HN HtHH^ HHHHA H0H;uEHHtHE HGXLHD$ DHT$@Igu?8HGXHL$@DGE3HWf\$8HD$0t$(\$ ޢH9_@taHGXLDHD$ HUI|gu>8kHGXHMDGE3HWf\$8HD$0t$(\$ r9H9_0u5LGXE3ɺItLGXE3ɋIgtHw8H9]HD$@HL$@VE3H@( iHD$@HDNLHVH\$(H@8HL$ HL$@hF9LG(HL$@IKtrH9_0toLG(HUHO@t]LG(HMIu%HW(HMt8LG(HMIt$HO0ILG(HH@;ht DADHMoHL$@eL$`AI[8Is@I{HIA_A^A]A\]H\$DD$UVWATAUAVAWH@d$4HI ALLHu A$H(2Ƅ$E2D$0@2A$MHT$8H-3HH9A8$/8VP#H Dt$8ffL$28$t $8$HHP MGHFhEO HD$(FdD$ 3҅HFHHH9AHDE3ejHH@ fDKHvEGHD;DfA;rEGIHR;HDE3jHH@ _fHjH;3҅SL$2!@ u8$t EEC u%8T$0u D$0Dt$4Dl$4E;DCH|EAfIC;F v{HFLMt^I@IAE3jjIH@ eDCHuDN I&:Df;{rDCHI5:ANH3A$@LHIGHFHHH?fjHFHHH`?gjvHFHHH=?HAE3hjHH@ dCHtEΉD$ EHF9HHFHHtTH>ijHE3HH@ EH`dDCHtH8f;{r{DHH 9NH@I@H$H@A_A^A]A\_^]H\$HT$UVWATAUAVAWHl$HH L=]Z3HEHЮL-OHEHH Q\$hHD$psHKhHD$xME\$TL}Lm]H]H]H]]H]uH]H]H]]eHHt@L8Lh0HsHA8H@Y@HYHHYPHAHYYHYq$HY(HY`HHH HOHH@bLEXHMHWDHGhDOH|$@HD$8GdD$0G D$(GD$ ]HHW0HMJHMHH\$`AHqHEt3DEILFHHHT$`I;aA;rEV HD$pHD$0LFHEE3HD$(HHD$`HD$ DuDt$XFH|0HOHH@aDFHMHWDHGhDOMD0H|$@HD$8GdD$0G D$(GD$ GGHW0HMHHMAHqHF hDExHHAX#tDDL$T:DExH:#upu8_tuDADt$X\$XDO HD$`LHu A$\$PADD$QA$DEtHwxMHT$TH)'HAH]AA8$MD$T;D$X?8_P3N ffMPEt \$QHGhMGEO HNV HD$(GdD$ 8]pHGHHHz:HDE3ejHH@ _DNH6pEGH4EfE;wrEGIH4HDE3jHH@ _HdHA4ZD$TMPF u;Et&F u 8\$Pu D$PD$h ;D$h(]PFH|0pEPfF;G v}HGLMtcIg9IEAE3jjIH@ ^DFH$oDO It3EfD;vrDFHI3AMHL|$`A$DLHIAMHT$TH$HH!UPDD$QHGHHH8fjHGHHH8gjzHGHHHf8HAE3hjHH@ ]FHmDL$THDD$hD$ k2HHGHHt[H 8ijHE3HH@ EH]DFHmH!2fD;vrDvEHH/2OHL|$`AIAHL$p貺HMBH$`HA_A^A]A\_^]LI[MCUVWHH`HeH?JeHHe Hكy`0HEH1HEydR@HEICE3HE LICHE8UBICGH} u H}8LHM8HH;E0u=FANI(F(A8N8IHFAAQHtHS0HDHtHHH\2HMH$H`_^]H\$Ht$WH0IcIHsHAwDIAAD;]D;TDA 3ɋfAuW G HЅx~<BA;HH5ifEuLDG LkHfE;rt6HArDAȺiD$(L$ LjH.DGDA@AƒA;~HDL$(iDD$ EAЍBD;tRHtnH4iHE3HH@ EHtZDHjH/AHH)/KH!2HtT$ LjiHB.H\$@Ht$HH0_HHXHpHxL` UAVAWHhHeHjPHeHHILHe'eeeHeHeHe7HEHEHEH͡HEHHEEHH@zYDDHG0HH@X3O HHLHO@LËuwOu DG A DHGhEHWH|$@HD$8GdD$0G D$(L$ HMD>t7HW0HMH@t&HE/HMH`HW0At A;sBkH i.4D$0oAHD$(DHa<IHD$ +2HM=L$I[ Is(I{0Mc8IA_A^]HHXHhHpDH WATAUAVAWHPLM3E2@2^f# LHuH$H!82gLfXHHfp I\:H$L$IO8LI5E3ۄt@ HHA AH|L$IAtlhgHHtRHMHH:CHG0HgHG8H4_@H_HH_PHGH__H_G$H_(H_`HHuHI9_0u$IGHHtL][kj*HH9EHXH\IE H;XHHuIOHH@VIWLDL|$@IGhHEOHD$8AGdD$0AG D$(AGD$ ;txIW0H=thLL$IH?t A3AAHHtA t AH|u 3A@HI3ۄ33HH9t H$H8'HtHHHU@H$HI@L\$PI[0Ik8Is@IA_A^A]A\_HHXHpHx UATAUAVAWHhH3E]HKHEHAHEMH9MHEHHHHEDH]H]H]]H]H]H]']wMB BH|I 豿LHDHEHD$(LMHEwLIHD$ MHt2GHANHD8JD1HN8BLIH 8]IHGHAOHD8JD9HN8@B@HI8/B@B BH|I վLH DgHEHD$(LMHEwLIHD$ MHt6GHANHD8JD1I>MH|$ MIHa ;8]u;IHGHAL$HD8JD!IX>HV0I;@@IpDuw9I.>HV0I;IOX@A$Шt-AD$t#IGAHEEtHUH@"@HM8L$I[0Is8I{HIA_A^A]A\]H\$Hl$Ht$WATAUAVAWHPZE3ME)ILEAH\E>h?HHtTHHHH>HG0H?HG8H Do@LoHLoPHGLoDoLoG$Lo(Lo`IHIOHH@QIWLDL|$@IGhHEOHD$8AGdD$0AG D$(AGD$ )7IW0H8tpHOXAHJ$tB H|tH\DB$uHtHHHQHHHHQE8.HuBE.6HtHHHPHtHHHPA2HNXAHYHHHDC*3@{ tCH|t HI fEf } HH;IW0H"9HNXA$@t&AD$tH$HN@8H$H H$D)HHHP@L\$PI[0Ik8Is@IA_A^A]A\_H\$HT$UVWATAUAVAWHl$H3EH=H]HELHHMHEHFHEHw;HEHHEHqHE]]H]H]H]Ӊ]H]H]H]]wHUoHEwHD$(LMHEE3IHD$ u 8]wHUAABDd$cB$AUHEHDEEJDd$HHt HI HEHHtHpAHMINHH@tNINhLAFIVLt$@HL$8ANdL$0DAN L$(ANL$ HM3IV0HM5HUHEt H}0Lu@7HHH+?MtII HHH?@2HL$POL$@IkIsI{ IA^Ht$WH0HaxHH@HtHH>HgpHOHGP@taHt LA3UjH@tcvHtHHGHHt$HW@E3D$(Ad$ HHR(u2HtHH>HgHHt$@H0_HHXHpWHPH` HH`AH@toV HHD$0LFHD$@E3HD$(HHD$xHD$ Z@t5HD$xHHCxHD$@HHCpCtHH\$`@Ht$hHP_Hl$Ht$WHPHAxH@ 3HVxBHLHH9nHtVFuF HHHHpHNHDBHQjHNxAHDHNHHHHH9uth訧HtRH 3HH ~(HH0H HH8H xh@HhHHhPHHHhhHh@$Hh(Hh`HHH@8ntuHHHR5HNH~xHH@;HNhFDGHVHt$@HL$8NdDMD8L$0N L$(NL$ H`!tSHV0H #t?H@ntHHXAHQHHVxB SHl$`Ht$hHP_DFPHnx2FpH\$Ht$WHPytH#HH[uHA8HPBHJGtHHu3HpHSHOHH@:HWLHDHGhDOH|$@HD$8GdD$0G D$(GD$ 8 tsHW0H!t_HHHXAHGtHHOxHGx@ t HH9\tHHOxHGx@ tHGx@ tPH9\uHgxGp2H\$`Ht$hHP_H\$Hl$Ht$WH AIHH;t@ tLHH!HuH\$0Hl$8Ht$@H _H\$Hl$Ht$WAVAWH@H3IpILBtt,3AHCx@ t AtDHLHHD$0L{xHt$(HL|$ u-I9/u(HCpHtHH8H.H9.HCpCtH!{pu@8ktu AIHKxA u/AHHKxA AH|tyHum%@8ktu HA(Hu3qHC8HHAHQHCtHSxB tBH|t HtCpHHJ{pu@8ktu AHCx@/H\$`Hl$hHt$pH@A_A^_H\$WH ypHHAx@ u~ytt%HHtHH47HLLHSxHH@HcxHtLI6H@Cp2H\$0H _@SH HQxHB u+B 9uHDHuH [@SH HQxHB t 0B ;GHDHHCxH H [H\$ UVWH 3HH9tELL$H3LD$PHL$@u2H|$PH;|$HHC|$H3t$@HH;HG8诠HHt#HHH HIH(Hhfh0Hh Hh(h4HHtF 3҉C4DŋD$@HǿHC N HH;s HfDHuAHIH@H\$XH _^]H\$Hl$HT$VWAVH0HIHIIHH@4HE3DAD_Hu D3mHT$XHHHHA H9A(riHYH9t`HDO HO0D\$ LC(HSHH HK(Ht 袠Ls(HK Ht萠HLs 脠0"HHtHH@Lp(DpLp LpfDpIHDO HLD$XHtNH HHCHAHHKHHH[HHHHHHXHHKDG HK(@IHt,HK(Ht ˟Ls(HK Ht蹟HLs 譟@H\$PHl$`H0A^_^LE3HBLI@LBHIHHRL9R(tA4H)A(fD;RsNIQ EfAMJHH JDJDIQ JDHH JJIA N IA NLfE;QrHALHT$D@AMcxGMIIJHA H9Pt2 H@ IH;uH@ I JDIJIxHT$3HHXHhHpHx AVH HfQ003HtHH@Hh(hHh HhfhHHGHfpIHGhHGHh(HGHhH_KHI@H袜HC HtKf;ks HC fHHHC H\f;SrθHI@HYHH2H\$0Hl$8Ht$@H|$HH A^LD$SUVWATAVAWH Dr0HHEAHL$`3A.HL$`AT$3fE;s3A+ԅ3HL$h\.HL$h uHfAfA;r͸HHfkH@H艛HC HtHf;{s!HC fAHHHC H\f;SrHD$pIHCD{AHC(HuU2H A_A^A\_^][HHK DNMfAI@ JJHC NDHK JHJ J\IH Jf;{rN4AHN(H\$WH 3AXHyHq#HHHyHHy 3Hy0AHyD\$ 8\$PHu8H F@(D$EBNjHHtHdH_H3f__$HGHHIL$E艋HGHEHHN@HGf\HBIFIV0H D@HEHHH f;uA9F0u H0fD;tÈG$HL$pHEHHHGEPfGAHD|$ A0LD$PHUIB&DuL LmAIAuAFMtEtA;s MdAFLMD~E;~MtEt E;sKLHHL$XHI$HIH@/7IT$HHEHMHfHBAHEH]]H]]'XL{M\$MR0aHLMLT$(ALA/D$ tHT$X\$PLJAA@ EBBfD$@HBHD$8HD$P\$0HD$(L$ Hc+8\$Pv&D$hL$`H H HH@PfHHHM0AE;AF;CD$QHtHHHHL$p}\$QHMUHL$p|HhA_A^A]A\_^[]HM0@USVWATAUAVAWH$HH3H3HL`LHhHMEDL$lMLEHT$xTHdH 3HHExWHHHHe{HHMpHHHHHHHHH\$ZH]\$SE\$p@|$X\$hHHD$pH%HEHHE%uH ,D$0AiIV0LL$XA $LHD$[YuH x,SD$0H\$RAHD$ LD$RIHUfDu8t$\8\$RE3H/HH HEDHD$ LH(HMrjt 9uu rH HEHtxsDEINHAvHH3HA_A^A]A\_^[]H\$WHHLHL$@w=AA@HL$@DG<3HWHf\$8EBH\$0D$(0D$ >t$H9$t$E3HL$@H'KHL$@=H$H_H\$VHHDHL$@<$HL$@HVH3f\$8H\$0DD$(DFtpE3HL$@HJu9H9$t3H$HL$@aNtL$HL$@HhJtH9$uL$HL$@H1QHL$@\$DD$@H H H_0HH;_0HT$HAE3HGHHt!HHt0jLO0L EHL$p4HL$HHM3L$0AI[0Is8I{@IA_A^A]A\]H?Hu4HGHHtHHtLO0LL {jH\$ M{H.HExE3LHD$ IHL$HLD$XE8huH#fA@ tHExHE/%HHXHhHpDH WATAUAVAWH0AMLH+u5HFHHt!HHtLN0LW -jA2D$@2L$3ADˉl$ MIHtyI]hAUXHt];$uTHF(MD$HHD$(Dd$ 詀u/Au&AFf9CuA9uAFf9Cu AFA8CAu@\$x@n@H\$`Hl$hHt$pH0A_A^A]A\_HHXHpHxUATAUAVAWHhH3HpHEEHJDMHELHIHuHELH@HEufuHuHuuHuu u4IGHHt!HHtMO0L -jAI9}HuI9HEHD$0LMHEHD$(LEHEHUHD$ kD9euH9uutI9tyHEHD$0LMHEHD$(LEHE'HUHD$ 蠥tID9euCH9ut=HEEMHD$ IIHEIExEfA]H}H H I;_0u2I]MDIHtUE9euOI}xfAGHI;HuIGHHt&HHtMO0Lr{jH\$ sA@@@@HM HM蔭L$@I[0Is8I{@IA_A^A]A\]A6@@HA6ME3HIwHHtA86uIWHHML=HE9qD9 r9dD9 [MMc@8ptH9puˉMME3HIIwHH%A86IWHHMLĭt|HE9D9 Mu@8pu&EG0u*8^u%8^ u 3uD9vuNMHItGE3E3HImHHu@HL$ :L\$P@I[0Ik8IsHIA_A^A]A\_@8^u @~t@NHH$H$fIpA<$@@SH HHu~E3AAP BtkPWHtHOHHtHHxptH<u)HHtHHH2H [HHXHpHx UATAUAVAWHhHLq(HY<3HqHLHEHHx6LHEHzHEH2HEH}}f}H}H}}H}}'H f|$8E3H|$0DD$( HI͉|$ $MAG0IOEgIG0H DafEkAfEmHEgHEgwI_HHMAE+IwE>HuDu@}H]tT9~tRHUHM6tALF@8~tLFHMHL$(LMgIfD$ 蹔tDfEw@E;r@HMHM藠L$@I[8Is@I{HIA_A^A]A\]H\$UVWATAUAVAWHl$HH4E3HHD$xH HD$HHW1LHL$pHL$@H HMHMHLmDmfDmLmLl$PDl$XfDl$\Ll$`LmDmHELmDmLmDmHELmDmHu@<tnE3@DHAx !tHL9ihtxHHB IuEtHHT$pE3HH@(vAHMHMHL$@賞HL$p詞H$X@HA_A^A]A\_^]E3E33HhHHt?uE3E3HHhHHuH]H8t O9HHGHE3E3HhHuH*DOHL$@HSHL@t$ oLmHD9HEHD$0LL$hHEPHD$(LE`HEhHUHD$ ƔHT$P9E`uID8jtHBH9D$huHK0HCDC0H DHf9MlxD9EhnfD9MncBf9EPUHUHL$@肺?HEHUH+DA+u HEuHD9t HU褒HHjHT$@HxHI9HHXHhHp D@WATAUAVAWH0HAMDq@LL@2hII}HIϋD+I]蕜I_EwAwI ;t)T$pMI@:uIGEu@hA;r@H\$`@Ht$xHl$hH0A_A^A]A\_HHXHpHx UATAUAVAWHhHE3H{HEHHU0H ^HEAH,HHEHEHGLeDeHMLeDe'LeDeHMLeDeLeDefDeLeD9` ufD9`$ufD9`&tH0uHB8HaHUHelHFLEAHϋHWDȋJ+JL9g0u*D9b u$fD9b$ufD9b&uHF8 t ssALFA9HE8`t E}B(fA@HGf@(HGDpPH_HHMEE+Lo蛚A}LmD}DeH]t+LG(HMH蔹E9eEuD@E;rLOHFAEAK1HE+IHHFHWHJHVHOHDBL9HF8 G0HUEgHG0H fEkHGHfMmHHEgHEg޶t9HFMHD8`tL@HUHT$(LMgfL$ HYu4HOHFDAPD+HHE+HHFHWH)J|HH؄t.HOD9a u$fD9a$ufD9a&uHFD8`u @tfAHGf9H(v-HE3ɋHHD$(HEgHD$ _uAHMHMHM苘L$I[8Is@I{HIA_A^A]A\]@USVWATAUAVAWHl$H3HHELH\)LHIHHEA^E3E33I`HunIUIcF@IG0@8ruHHRHcMwHH;~EIE9tI90t2E3IE3uIE3IIH@(|IHH@(`LHREt3IHH@8;IHH@('Ht%H9x0uIHUE=H}AF0EgIF0H fEkIFHfMmIHHLAG0HU߉EgIG0H fEkIGHfMmIHEgHE,IELH@8ptL@HUHT$(LMfL$ I裈ywLM,MLAIa3I觴IOHEgHA Et-IUIcF@IG0@8ruHHRHcMwHH;IE3IIH@(II t}AG0HU߉EgIG0H fEkIGHfMmIHEgHEIELH@8ptL@HUHT$(LMfL$ I|[SIIHI@8q81HILHX\H\$Hl$Ht$ WH`HA3IHH9p f9p$f9p&EuAH9tau2HT$ HtE3HT$ LHtHHH@8*HHH@(HHLE3E33H\HHN0HL$pH fD$tfD$vHD$pLH I0IL ‹I L I Iw(HH)#HHH@ HFf!HHHH@ ^Hy8tHV0LHIWHHHH@8&LHtHHI HHH@8E3E3HH"qHHH@(HHHHHH@ L\$`I[Ik Is(I_H\$HT$UVWATAUAVAWHH`3HoHEMHI%HHELDH}}f}H}IHtwHEHD$(IHEXMHHD$ ͉HH9EXrHdIT@hQHDAIΉ@EAFDD$(E3ɉEIΉ|$ HHIGEo@@EXA;I_HHMDD+MgݏHUHH]LeDm@}A9$t}A9$wuuRA8|$ vKE\$ DmEED$ ME;EBEtLM+C DAM@+u EuAA+˅!A9|$tTEXAD$Eo@EXA;Q EXHUHA;G@s+A$;tIHM6H Iu HD HD@HM軎H$@H`A_A^A]A\_^]H\$ UVWATAUAVAWH$PHHfH3HHHLHML LH(HD$PDL$@LD$XfH; H LHE(HHM 3HD$`DH,HHL$pL$xHMMHM HD$h6HHHL$`I'LD$`I$$HT$DHD$DDL$DA3A3A|$@Ct AuuHD$`HLD$AHD$ HU LL$HHt$ LE IHM1HD$HIHEI$}tMHMHDLD$`HHT$D5HHT$PtHL$XHU N6EtE3E3IHTtu9^0ur` ufEtaHGHHHH@(uEH~8tHE3AHHdH˄tv>IHfH\$@Hl$HHt$PH A_A^_H\$HT$UVWATAUAVAWH$HLMHM0ELYHL$`YAO@AH`MIWHLD$8EGDAHL$PHMOPL$`I[0Is8IA_A^A\_]ûHU2LHu{L3H˩A0A03AFHINfA~ Av袩HAvIN$IF,IF4AF$E3HMDIYI΄u *36 3IHMX[u H HHLI[IkIsWATAUAVAWHPEIC ICLIC0LICE3ICAIICMAW3H$HtHUH@8$t3JA^+f#0HHu "L3HRAFf_fHOADfGIfDw fo H$E3AHID;@D; "XHτu11@8$tIIYY{HL$@H$AHD H;u3uHCHHtUHHtI-j2E3HT$0HEA uPHCHHt!HHt1jLK0L&]@2HL$0mL\$`@I[IkIs I_DCtD9>t7E3E3HHi/HHuݰL$I[0Is@IA_A^A]_]IWtIE3VIH@YHtDFHIN ԐMF IHWHe[HH-2H9uHErHH]HEH{HE]H]]H]H9HEHD$0LMHEgHD$(LEHEHUHD$ [t[IM9EuAf9EguHO0HGDG0H Pf9MuD9Euf9UuH9t HU[YHEHMƿ%H\$WHHHL$@DG@2H\$`@Hl$hHt$pH0A_A^A]A\_AHHHtHD$xEHD$(EHHt$ I uMtA>HDd$xE3HEt5EMJ|tN HNDL+HtJDE;rH;] }H] H;E(~HE(HU0H\$UVWH0HHQLG(HHW u H52hHG3h tIHD$`LL$XHD$ LD$hHtLD$XItLL$`HHT$ht;rHO HK HO(HK(H\$PH0_^]@USVWAVHH@HE3LM@HD$ LE8Hu HF(H9F yH]8H;^ tnHE8AAHD$ LM@HLEHIH}t9H}@tHH]HH;uH}8AHE8AHD$ LM@HLEH HH;F(H@A^_^[]LL$ HT$SH0HM2wIumHH uIH uHItcD$ tHC(H9C uHD$HHC HT$XHHS(HD$HH;C }HC HD$HHD$XH;C(~HC(2H0[LI[WH@AICMC ICMKH%t&HT$hLD$0@tIH;C(uHS(HK3hH\$PH@_H\$Hl$VWATAVAWH0Hy MHHt2Hy(H;t}H\$hHl$pH0A_A^A\_^H+HH uHWE3LD$`Dt Ht$`Hu3HtA;LL$`HIDBEEuAuMHHbLD$`MHU(H$tI+LI[WH@HIICIICIMKMCgtHD$PHL$pHHD$0HHD$8HH\$XH@_H\$Ht$ HT$UWAVHHPIIIHLu H;Q H;Q(HILMLE fL6HGP uHt HG(H+E(HHELMHD$ LE HttHE(H;E ~HtHO(H+H HE3LMHD$ LE Ht:HE(H;E }0HtH+G HtHEHHE I;uL6nHf2L\$PI[0Is8IA^_]@USVWATAUAVAWHl$HH H3HELuHHME3HMwHMLMLEHUMtE&HF(H9F u$D9eou2FL"M AD!/HF@ EHhHEHHtEH^ HDeED9evxHEALMHD$ LEHtHMHuEu4EutIG0DH}gEnMEM AɃtMAHD$(L.it$ IaT$DeAu OREO0LIr`@DHD$X@0;vAPtpt tuAYIE3E3I%LH6IG9X f9X$f9X&EuXMO0LjI+aDt$DeAQEO0LI_IGf!H|@|$@;8\$@uQMO0LjI`Dt$DeA?QEO0LIb_IG@f!HDt$D@uAX3AuHE@8AFA Ia EʺjIfI$AE3 jIH@ MG0HɜI`IWAI`AL$HAֹe\PEO0L͓I^IGf!HAFA}uUAtOI t@AH fD$0HD$(DHc<IHD$ DO^@@@HM`gHM讝HM襝HM(蜝HM蓝HL$hYA@HH3hHA_A^A]A\_^[]HLH L@HPHHUSVWATAUAVAWHHE3HHD$XHHvHH |oHD$`HIHMIHMHMXHM(HMXHEHEHE`HE0Ld$hDd$pfDd$tLd$xLeDeLeDeLeDeLeDeLehDepLexDLe8De@LeHDePeLLu5H SeD$0EL$HD$(ED$<L\$ I]E3Dd$@E3Dd$A3HEMJ HD$HLHHVHHL$XM@Ll$hE8eu LeHNHI]Lc~LcK@HT$PLC0HMH@8H|$(HT$ HSt"C@9D$Pu@HKHH@(e@S@AHKE3裐H\$X@H@_H\$Hl$Ht$WAVAWH@MIHMtADA@LQK,HAJ%}ȃI4 HFLH;DADNEu6HNLHG0EHD$(jL$ HRAt1Ht{NLΏHG0jHD$0L$(HD\$ _ROHNIH;wE;vZHt9NL܏HG0HHD$8H+։L$0HD\$(HHT$ jRO@+̓DzLIDAujEJA+A)A;Ht&HG0jHD$0HDD$(Ll$ QO@HG+͉HMtAH[e>IGH;vGHNIPHG0LHD$8MωL$0M+D\$(HHT$ j4QDNEu6HNLRHG0EHD$(jL$ HPAt1Ht|NL*HG0jHD$0L$(HD\$ PPIWIH;w E;wHwHt5NLCHG0IHD$8I+҉L$0HD\$(HT$ jiPO@+̓AHGHMtAHteDO0L6HN3H\$`Hl$hHt$pH@A_A^_@SH DA@LDAHًRIID+w3E3E3HHHuH [LI[IkIsI{ AVH`3HqICHHhHICI[؍S \$Hf\$LI[Ht^HVHHL$0L2tIHn(HDvLD$HHT$Xu&HL$HHtHAHsE3Ld$HBLd$H{uMLsIHe !MtI$AIHsE2HM0HMH9HM`HMHL$X)H$AHPA_A^A]A\_^]MtI$AIHstH)DvH\$Ht$WH qHًHHtHH\$0H _@SH H7`HH3HAHAA H([HTHH [@SH HaHHaa H(OuHcHcc H [̋A H\$WH HyHHu-H(HCHCHu2OH`HCH HC3H(cHKHHtHKHHHHCHHKH!HCHxC H\$0H _H\$LHLBMIHtI@HAIHHtIHM9AuIIAM9AuI@IAI3HBMQ8IXMtLDY3AA+BArA;BrAMT8Mt(AJA@E3D$(A!L$ Iω$\LHGH$$H3E3tD;/vGAH;rM;H\$pD;/uCHDGIDOLD$(HD$ ݅~GAƋ$H;rH$;stD$D;/ugGD;u^WMMHI1uEHtH;_~9GAH;r'D;/u"uHtH;_~GAH;rH$Ht0H$HtD0MtIHH\$xH0A_A^A]A\_^]H\$Hl$Ht$WH`HIIAH}HT$P3H]@}HH} H^XfHVhLHF`Ht-NPDÊDND$0fL$(HH|$ uAANSDNPDVMHVp|$HfL$@HfDL$8LH|$0DT$(HD$ 뻰L\$`I[IkIs I_H\$Hl$Ht$ WH0HcH3H$ YHvQHHtV@H|$ @2LHH/VHHDB5INLHH/@t HtHMH$ H3*L$0I[Ik Is(I_HHXHhHpHx ATAVAWH@LLH8HE3@_HߋA+;+uHHDCOLDKHWD$(HD$ 赂uHCH9G|JH;G3u2HCH9G|( Cf9Grv9H[_@2HCHHAƋA+;sdUHFHt(HHtGL[D8jD$ AVH AHA@2@H\$`Hl$hHt$pH|$xH@A_A^A\HFHt6HHt*CLWDD$0D$(T$ 7jHZt AS2HHXHhHpHx ATAVAWH0AiIED$(d$ HHE3ALWIL+Hu H3/D9;u!C;uSLMHI,t CH;r;r2HL$pHSIHH\$PHl$XHt$`H|$hH0A_A^A\H\$WH H(t HtHHH\$0H _@SH H?HHH2HH [@SH yHtHIHt 軵HcHccHc CH [HHXHhHpHx AVH AIHH|$PuHs{CHk 6HHCHu He2Llj{HCHHk L+H\$0Hl$8Ht$@H|$HH A^H\$Ht$WH IHHH_CH\$0GHw Ht$8GH _H\$Hl$Ht$WH0AHDAHHI3A*9Ss2HCE3LT$`0HCDXHKD$hfA Mt4HKABA HCfP HKA fffA f#fAHCDX HCfDX HCfPHCxHKD$pAOHSBȃJHKC9AOMtDI DA LD\$(IDD$ ^THCLHHH)H\$@Hl$HHt$PH0_H\$LL$ LD$UVWAVAWH@$LHٿ@f#tHDA3HIZ)9Cs2HKf$E3f#HC@HCfp H$Ht.HKFA HCfx HKA fffA f#fA HCDx HCfDx HCfx HK$A"HKH$HA(ft!HT$pICHc$HHCHH@HKH$HA0HKH$HA8Ht0HKDA Q BB;CL D|$(HDD$ RHSL$KL|$0B +LHLD$(LD$pL$ InHKHT$pD$HAHQLKAQ DAEAH\$xH@A_A^_^]HDH D@HPUSVWATAUAVAWHhHHyH8E3HD$PHLHEWDgHD}AW@L}‰E_EAs@HA HHHGD$0D$(D$ E̺iDwAr@HA HJHH:GLTD$(iD$ EAHEhE:ufO tHGHEHuAE_E_Eu>As8HC HHHGD$0D$(D$ 4E:uAD;s4HC HHHxGD$0D$(T$ @7prF0wHH`Do  D DW CzA; D_ E3AI;EtfD9B(AA:rMWLD$@IE3D$@HUgH HRHETDoJBHC E3HaHHQiyEu0D9GHK H!HHEt i4DOiDD$(LQHD$ 0j- t|tw  O HHH;xHAH;gAf;VEMHC H]HHM{EHHHEXH\$0Hl$8Ht$@DpH|$HH A^H\$WH H(t HtHNHH\$0H _@SH Hg HHHHH [@SH aHكaHIHt HcC(Hc H [H\$Hl$Ht$WH IAHD$`H_ ȉGG(G0H8sHz2~3HGHtDG3HHGDC(HGpHOD$XAHOD$PA HGD@HG@ HWJJHOYHWJDDDCfDDH\$0Hl$8Ht$@H _HHXHhHpHx ATAVAWH0LQMIHL3ABIZHC uHIG LCIODK U HD$(AHMD$ 躘xuttȉC@Hl$X@H|$hHt$`IH\$PH0A_A^A\H\$WLIHDZHIA+EAEPE+EADHIE‹AAHG)CH\$_H% HAE3LD$DA(LA0Au@EKADXI@AIHIHAA3IHQHHBfDJBEuAfBHD$HDH\$WH HwHH>tH }HH\$0H _HHXHpHx HPUAVAWHhH3MALEuHQPHIHP IOHAF0HUD$DHF0H fD$HHFHfL$JHHD$DII8uAH "=D$0CHD$(AH<IHD$ EA'IVHMfEf A0f\$BLD$@|$ HT$`HALmMt.MfDIALCOAEAAD\$BfALD$@HT$`A0D$ Hf\$BIuL|$PMIO(|LHu ZF0D$DHF0H fD$HHFHfL$JHD$DIfA~ IG N0L4HF0I9G~IGHF0I9G}IGHL$`2@HM(H3 L$0I[0Is8I{@IA_A^A]A\]H\$Ht$L$WH IHAH@3mHWAA[AHT$0HAH׋7DG@HWBE#H\$8Ht$@H _H\$Ht$WH HHHѻD3=Er G0uHW DËH\$0Ht$8H _H\$WH H'HHtHYeHH\$0H _HHXHpL@UWAVHhH HEHMLD0HBH HL$XW3HD$`HΈ\$pE3H\$hID$x.HNH~H AHMHHL$`H &HMHMHM@]E\$pD$xHEEH]]HEE H]0]8.HAH A@WHEHHHMIOHEЈ]HH]H@3ҋIOH(HHBHNpljD$PH6E3L GQHM:  McOH Ht1LD$XH8RuH ՞HD$0w(HM@L0AG<3Aw<\$0MDHH8Dt$(HD$ tVt(DD$PH H\$(HM@E3HD$ 3Gu&L9eH|PL08tMHM@I8tEt(GutL@E3IItHHD(HH ӝHXAD$0L%*HD$(AELd$ <qDHMEFHM@4*HL$`zHMqAHA_A^A]A\_^[]@WHLHHL$03)H'HT$0Hd$ L$AIFtH$HtE3L3<HHD$ 萦3MJIm?=E;HIH#I;HDžH HH HH HH L DžL L HHDž H HD$(HH <\$ ;LD3D #H@DQE;HIH#I;HDžH HH0 HH@ HHP L( Dž L8 LH HHDžX H HD$(HH ]\$ \LeAD @3EI9O`E;v^H@H'tKIH#I;u@QHDžHEfUHHHD$(H T$ Hҥ %LH LHHHHD$`IHUHHD$  %DЈD$a H HD hLyHHH+UAH@H KIH#I;HDžH HH A‰HH HH L DžL L HHDž H` HD$(HߊH \$ 莤LD xDT$aED$hfD$pAvaH@HYtNIH#I;uCHEfDuHHDžHHD$(H2H D$  %LH LD$h HHHHD$`IHD$HD$bD$@EH|$8D$0D$tD$(HHUIHD$ C %DȈD$b H HHHH+U=fH@H _HZH#H;PHDžH HH AHH HH L DžL L HHDž H HD$(HH \$ 蚢DL$b3ExD$pH]f;D$hML$tDDD$hIH|$(L$ I蛁=<D$bH@H1H ,H#H; "H3HH@ H` HHDžHp LH Dž_HP LX Lh HHDžx H HD$(HH lD$ gD$b3Ʉqf9L$hXI83} DuKC KtIWHL9>HT$`HHAE3HH@ HkH胞=t$xH@H HH#H;HDžH 3HL H HH HH Dž`L L HHDž H HD$(HKH D$ MDD$hHD$`HD$8LHH|$0HD$(IԋD$tIωD$ Š=D$bI@LHHI#H;H3HHH HHDžH0LDžaHLL(HHDž8H HD$(H$H D$ ϞD$buI+63qH@E3ufDL$hHD$`HD$PHUH|$HHHD$@MċD$tIωD$8HHD$0HpHD$(H@HD$ ,E3AЄt@փ=(T$eI@L HI#H;HDžH`HHp‰HHHHLhDžbLxLLHDžH@HD$(HH ZD$ U38D$eUD$ctP} uKC K;t} u fCfS@t$cIOHDHD$l9CtC@{HT$`@t$cHHAE3HH@ HCH[} uKC K3ۅt$IWHL9D$cD$c3ۄHT$`t$xH0HAE3HH@ BHHי=#H@H HH#H;HDžHHHHHHHLDžcLLHHDžHHD$(HH UD$ P3H@=3:H 6H1H#H;'HDžH HH0HH@H HPL(Dž!L8LHH HDžXHHD$(HƀH vD$ qH@=XvcH _tZH^H#H;TuGHDžfEHEHHHD$(H,H D$ % DD$tLH HHHዅIψD$0HHD$(HD$`HUHHD$ Z %DȈD$bHDHH HH H+UD;I@LaHI#H;HDžH HH0AHH@H(HPL(Dž"L8LHH(HDžXHHD$(H~H \$ 蟘H DDL$b  E3EYH@D;H[HH#H;H Dž H HH HH H0H L Dž#L L L0HDž H HD$(H}H \$ 袗H E3DH@D8UD;vVHttMHH#H;uBHEf]H@HDžHH HD$(HNH D$  % H LHHHIHUHe %DD$b H HHHH+U9I@L HI#H;HDžHHHA H HH8HLDž)LLH8HDžH`HD$(H:|H \$ DD$bE3ED9T$xt;EƉHMt=+t;uPhD$tҁgLHV@E3҈T$d$LeH6E3A҈T$dT$d97I@L0H+I#H;!H$Dž$ HH(H‰,H,HH@HLDž(d LLL@HDžHHD$(HzH m\$ lHH f3HMH`HHMH]Љ]HEH]]HpxHhH HH`w MD$lHc3HHH uw L$`H@t$`HH H HAE3HH@ DLHHMHA SLEHH\$`E3D9HcT$lH„tHEWHH HEEHAUHH@ DMLHHMHA 诂DLHHpHE3zLpHHLEH E3D9HcT$lH„tHHºVH HEEHAE3HH@  DMLHHMHA ЁDLHHpHE3蛁LpHiLEH-E3D9HcT$lH„tHHUH غHAE3HH@ /DLEH2HMDCHDLHHpHE3ĀLpHLEHVE3MOHAEEA^DE;rnE;Q8shAAP< u0II0AAH Dt <AIA0uH A;QDuDDָD3D]EHcL$lAH8T$`tHD$|eHH HEEHAT$|E3HH@ ǺDMLHHMHA LEHH&MtsHAE3HH@ _UIOH:D$lLgHDSHMHA LEHH讌IOH!8HcL$lD$|H38L$`tHHº H HEEHAE3HH@ DMLHHMHA u~LEHHHAE3HH@ LDL$lL`HOHMHA ~LEHH誋HAE3HH@ DMLAHHMHA }LEH7HCHAE3HH@ DL$|LHHMHA F}LEHHߊ39D$tt$MtHp(uIz$3IO0HE343҄uHHH92I@LHI#H;L$lHHHEHPHPHHIO0HHDžHDžHH@GT$lM0H0HDžH H`IOHHDžHDž(HXHXHH`H HDž8HDžHHDžXHDžhHhHhH0HDžxHDžHpHpH@EHxHxHPD$|HHH`HHpUHHH%6D$lHDžHHHHHD$(HQqH D$ 蕊3DI8Ut@9fH@H_HZH#H;PH4Dž4H@3H8HDžHHPH<H`HHpDž8$HDžX<HDžhHHDžxH HD$(HoH \$ 萉39\$tu8@t&D$duHIuMtTI JMtHI >H l`ϏD$0AHD$(DH:<HHD$ 茇@H`HHM:HEE38HH@ ֳHSHk@HH7H0+HHH`HSEHHHpHpH@@HH3 H$HĠA_A^A]A\_^]@USVWATAUAVAWHl$HH8H3HED0IHEMHELL$@HD$DD$HHD$(LHD$HD$@HHD$ HIHLADeE36=vI@@t$@LjHeI#H;[HD$LD$LHE3HD$PHEHE@ƉD$DHD$DHEHEHED$PHEHEHMHEHEHD$(HmH D$ @HUHHAE3 HH@ L»HH#HKhDRt@HCHLLC0HShHK`Dd$(HD$ WE3tHK`HHH@,EH C]覌DD$0<HD$(<HAHHD$ c2E3Ld$(LD$@E3Dd$ HUHץ=@H@HH H#H; HD$DD$DHEHD$PHE@ƉD$LHD$LHEHEHEHED$PQHEHELeHEHEHD$(HSkH D$ @u+HUHH \qD$0hAD8d$@Xut^HC`;t0HKht)HCHLLC0HShHK`t$(HD$ UH [D$0zLMIH!=>@H@H4H /H#H; %HD$DD$D HEHD$PHE@ƉD$LHD$LHEHEHEHED$P& HEHELeHEHEHD$(HiH D$ 范@HK`HHH@v=_I@LXH SI#H; IHL$DD$PHD$PHEHD$LHEHEHED$DHMHEHED$LHELeHEHEHD$(HiH D$ 豂HUH}HAE3eHH@ LHHAEtAtAGHMH31HA_A^A]A\_^[]@USVWATAUAVAWHl$HHdH3HEHd$xHeWHD$XHHMHD$`M芁LD$huDHK0HH@D$LHKHE3l3HKhiE3HLC0HL$XHShDDd$ vDD$L3HL$hEՎHL$XE3ۄtHL$XE3ۄHKHDAD7=QH@HtHH#H;@tAÄHD$@D$@HEHD$DHEHD$HHEHD$PHEHE|$DHED$H'HEL\$PHEHEHD$(HfH ?D$ :0AMME DIAM#C HKht9HCHLLC0HShHK`t$(HD$ eQtAMADH VQD$0(HD$(AHDǺ<HD$ I~H VD$0IAE3IH@ aHޮI|=;H@H4H/H#H;%HD$HD$HHE3HD$DHEHEHD$@HEHD$PHE|$DHED$@%HEHL$PHEHEHD$(HdH D$ ~@2@HMH3bHA_A^A]A\_^[]HHXHpHxUATAUAVAWHhHHnE3HD$HHHEH HAHL$@HEWHMHEEDl$PHMDmfELmfDmDmDmLmLmLmLmLmDmD$XuHO0HH@3DDA؅tHL$@\HGHHT$@LG0HM\$0Lωt$(HD$ :^HuHQHMuBH]wAEE3HHH@ HHzEwDAEDfD96cfD9nXfD9nMAL}H]wEffD9nt^VA;r HOH;Q8sDFE;r D;A8s$35IHCHEE3HH@ XHիHyfD9n t^V A;r HOH;Q8sDF E;r D;A8s25IH޻HEE3HH@ HpHyfD9nVA;r#HOH;Q8sDFE;rD;A8s V2IHrHEE3HH@ HHyH]wHUH3HDE3HH@ CHHxH@HH@0!txfD6DwfDnfDn fDnEtHMXuEwE9wtHABH Q`HMwD$0zDHD$(<HîDOHD$ yAHLmHMHEDmHL$@L$@I[0Is8I{@IA_A^A]A\]H\$ LD$T$UVWATAUAVAWHPE3LHIHED|$DAfA8N%HOG3HH@HHD$HHHuEH QiH$EOD$0DHD$(<HɭHD$ #x3Lk43H6H$EL$H$MEHAA@P< u4MH0 [ABHAB t <I@0uH A;P<AELk4Hl$0LL|$(IH|$ ЅtfA_IEHxP u:L@0 [AABHAB t xPH@0uH $3fDd$@fEu#HIMH.H$f9AĽfA+ȅt~H^DH~8H$DD9tOIMHHIͷIDE3IH@ H_IwuAD\$DH4H4M+uHt$H3MMHA܍CHcHk4DT0AAP< u5MA0C RABHAB t <IA0uBP BA;QH ]:iAD$0: HD$(<H)HHD$ EA|a2HM H3kH8A_A^A]A\_^[]H\$Ht$H|$HIRPDA u5LC0C RABHAB t HC0AʀuH O;S<LG AEIOA#AC!SP uDLC0C RAFAtHAB AAHB D 5HC0u Dp"DAHW H\$Ht$EIOH|$A#AAF!H\$UHHPHܢH3HEHMDvHEA;uHH+ 'H[ d;Gً wt3ɉ t A;LHME fE t(ttt tE.E.E.E.E.u IAE3IH@ H mLMDH7&^t@=Kt5H FAE3HH@ SH $Hɏ]HMH3iH\$hHP]HHLMtu@DD$hI͋U^F t $<AuÄ|$hH6nHH^IH@Hrd\$dHPHHXIEHH`hH@Hpx*IEIH@A HHI3M+uAHI3I+uDD$hHELMHD$ HM`,(;DMADMHEIDD$hHD$ 輓gM| Df+U|f#EzfD3fAHHMpA;rȉIEI͋|$hAD}H@8~HHL$d'IEIH@~L$aHHu4AHo*HPu4H )[YD$0UHPHHUIoI$EE3IH@ }LMHPLHD$ H*IP [#G}L$aHHu4AH)HP*u4H /)XD$0cHPH HUI覑I$EE3IH@ |HuHPLHD$ LIH2)5O=zH@HstHrH#H;hAtÄHD$dD$dHHD$lH HD$pH0HD$xH@HDžD$lEHDž(D|$pHDž8H\$xHDžHHHD$(H7H D$ PAHPE3H6AHME3H*9]tHHM LI M9AH<@DIEI͋|$hH@ {L$aHHu4AHh'HPu4H &TVD$0NHPH  HUID}dI$EE3IH@ xzHuHPLHD$ LIH&L=8H@H1tH0H#H;&AtÄHD$dD$dHHD$lH HD$pH0HD$xH@HDžD$lFHDž(D|$pHDž8H\$xHDžHHHD$(H4H oD$ jNAHPE3HAHME3Hف9]tHHM谈LItH9uHPHMtHP\Hu ʺ!8]jDeDmD}Et^HEH@HxP u3HP0C dA<HA t :xPH@0uB<`)B< D:u~F ~HuHUHHEE3 HH@ xDLEHHJ=ԌH@H͌tȞH#H;ŒAtÄHD$dD$dHHD$lH HD$pH0HD$xH@HDžD$lHHDž(D|$pHDž8H\$xHDžHHHD$(H[2H D$ LHU(H]rHEAƊ@ $<HAEE3HH@ vH:{HRIEtHuHNHDA@A9LeBHE@|$`Lm@tDD$hI͋U菍@\$`L8LELMPHMHt$(D$ 1uE3AHMHH@ vHMH}zH=݊H@H֊tHՊH#H;ˊAtÄHD$dD$dHHD$lH HD$pH0HD$xH@HDžD$lIHDž(D|$pHDž8H\$xHDžHHHD$(Hd0H D$ JELmDLeHLEfA;s+Hk4B9|!uF\! B9|!uF\!fAfA;rMUHAIt2u*If2uI1AIʋ1DDeDmEtDHuHNH D:u HMfAHELefpHu@|$` CHEHUDL$hHDEHD$PHELd$HHD$@8D$8HEHD$0HEfD$(HEHHD$ "* ܵ3LuDmAF $< D:EfAFAD HuHHH@ xsHwH F=RH@HKtHJH#H;@AtÄHD$dD$dHHD$lH HD$pH0HD$xH@HDžD$lJHDž(D|$pHDž8H\$xHDžHHHD$(H-H D$ GEHuEtMLUHLEfA;sHk4B9|t fAfA;rfUHNH/uHNH/HNHADA@ D:HEuP@ PHNH/EHMANHE@|$`]@tDD$hUHM@\$`LHufEfAHFHD;`8HfHFHHLF0HDd$(LHD$ HHH@2qHH9@~ 8tHHtHHtHpHHD9@~$8uHtHHtHxHH HHgHH;u Ff;lF :_HH;5Gf;,G :F $<G $<D$a :uFN ȊD$aNA;u*:uOG O;Mu9^u 9_HUHM蕄HMAE3HH@ oHMLEHSv6B={D}H@HptH oHH#H;AtÄHD$dD$d HHD$lH HD$pH0HD$xH@HDžD$lO HDž(D|$pHDž8H\$xHDžHHHD$(H)H D$ CL$a :u AfFfDf:u EfGEfG^_98t HHH@ [n 0UHHt%HXXH3SHHHGH_ _(HHU AHUE3Hv: LHMXA躄 LeHu9]uH`Hi D:AVAF H}HUHD}OHAE3HH@ am=JH@HCtHBH#H;8AtÄHD$dD$d HHD$lH HD$pH0HD$xH@HDžD$lM HDž(D|$pHDž8H\$xHDžHHHD$(H'H D$ |ALEHH2s?HEE3HH@ VlHpH>HAHH@04l=@D$tH@HtHH#H;AtÄHD$dD$dHHD$lH @ljD$pHD$pH0HD$xH@HDžD$lNHDž(HDž8H\$xHDžHHHD$(H&H JD$ E@@t&Af AHuHNHoELeAFL D:uANAF ANtHELEPHPH @|$`LmA@tDD$hI͋U@\$`LepIH;yuAFf;{yuAF :qy>IH;GyuAFf;AyuAF :7yLeAE3II$H@ Dj=-H@H&tH%H#H;AtÄHD$dD$d HHD$lH HD$pH0HD$xH@HDžD$lK HDž(D|$pHDž8H\$xHDžHHHD$(H$H d~D$ _>LEIHp;I$EE3IH@ 8iHmI;I$AIH@0i=}@D$tH@H}tH}H#H;}AtÄHD$dD$dHHD$lH @ƉD$pHD$pH0HD$xH@HDžD$lLHDž(HDž8H\$xHDžHHHD$(H{#H +}D$ &=@Af D:ufA^fA^A^AVHNH1AN t LuE>AF:t$<tLuE~AVtuLuE~AV LuH~HTuH9_0tH3GTOTuAAF3AF AFkd@\$`LeLmAt$hIEA։t$hIH@'gL$aMHEHp@,HUID}{I$EE3OIH@ fLEHmIo9DD$hI͋U}={H@H{tH{H#H;{AtÄHD$dD$dHHD$lH HD$pH0HD$xH@HDžD$l HDž(D|$pHDž8H\$xHDžHHHD$(H+!H zD$ :HuXIEI͋T$h@H@eL$aMH_Dd$h8tAIEEAIH@eL$aMHuLe@!HUI8zI$EE32IH@ LeH}HkLI7=zD}H@HztHzH#H; zAtÄHD$dD$dHHD$lH HD$pH0HD$xH@HDžD$l HDž(D|$pHDž8H\$xHDžHHHD$(HH RyD$ M9H}9]t(98t H`H`H@ *d0LmH5HAHHdL{hI6=xH@Hx~HxH#H;xgE HD$d \$lHEHHD$dH HD$lHDžH0HEH@HDž(HDž8H]HDžHHHD$(H xD$ 8H +>D$0 EEH o>D$0lH Y>D$0VH C>D$0h@H ->D$0*H >D$0H >D$0PHD$(EHrkEǺ<HD$ I5HPt=%wH@HwHwH#H;wEH,D$dPD|$lLH ]=D$0HMAEXH 7=D$0H !=D$0 ƒ=xv:H@Hqv#HlvH#H;bv HEEHHtHD$dD$d[H D$tD$lH 2 r4II\IEAE3IH@ GLD$HIHT$pILMpD$ HL$pyUHC8\>u5ExEpD>D>#E|fD>'D$@D>,D$DD>0Dt> L LHEpIH+D D+uIƅuEu|LgLIM+B8+uIƅuHT$PID>[IEAE3IH@ FLD$HHMIbHL$`HAfXvHT$PIr[IEAE3IH@ FLD$HH3MIID$LgLM+fXIB8+uIƅuD>9\>,HM ZHL$XHUD>,LɉD$(HAHLA0HMHD$ ltWHEHMH@EtAD>0;E`}08]tHMHMHtH HtHIHLcLLMujH !D$0AHD$(EHN<IHD$ HL$XD>0HIX;A@} LcLy LMHT$PIYIEAE3IH@ ELD$HHKIAG $<t-fA_9\>,t"9tHEHMH@ DqHMpI+HHtA t A$MI+uHuM+D$@A$D>,D$DD>0HD$hxDpHHXHpHxLh UAVAWHhHHV3LHEWHEHH 2HMH/HEHMHUM]MHUE]fEH]f]ω]ӈ]H]H]'H]H]WrIOHuIOHE3]At99]wtDGHFIIUHG̀zP u5HR0 @DH t AAAD zPHHB0uDH DAD;WLt$XANMF EIANA#C!IEHxP u6HP0C RDH t AAAD xPH@0uFP FAD;W{Lt$HHD$XEʊHL@ IHA#C!DGЋWIMH+DL$DHT$PEI;}HO49uGHӉH4I;|L$@A;G̉HcLrHk4HB LHML+B +uHÅuQMEHGAxP u2MH0 @BHB t AxPHI@0uH \$0HMT$(MLD$ HT$pME0HMHT$`DHL$HYQHL$HAE3HH@ i<DGLM(Lt$ HLt$HIGGE0GfE4E(tIHMu<2HL$pOHMHM`H3HxA_A^A]A\_^[]Lt$HL$@H)\$P+H4L$@+xLHT$hH 8HL$HAD$0DHD$(<HDHD$ aEZA|$NA\$DH\$UVWATAUAVAWH$PHH~QH3HHWHELH3HD$xMH&HMHEHMPHHEDD$tHU}EFH OHHY)HM(HEHHMHHEH}0}8HU H}@}HH}H}}HUH}}A$Ήt$HgLHuH lD$0>L3HE3HkuKIwH ,D$0HD$(HBDƺ<HD$ IDNI "A$؄uIL$0HH@9˻Љ|$\щ|$`DSsDkT$hDT$@\$DML$HA;Y8AAP< u0II0AAH Dt <IA0uH jHEDL\$P@#DHEHH@ H D8AAP< u0II0AAH Dt <IA0uBX BA;QDID3Ht$\IIL$HHEHD$(LL$XHD$MLHD$ E@8|$XHUILIEE3IH@ 7DH@I =LH@HLtHLH#H;L@t@DŽHD$pD$pH@HD$lHPHD$dH`HEHpHDžHD$l+HDžXt$dHDžhH}HDžxH HD$(HSH LD$  t$`MD$HA@P< u3MH0 [BH@B t <I@0uH A;P<A@P< u3MH0 [BH@B t <I@0uH N 2DA81^HED֊HLX IH#ACAut$`A CAHUIJIEE3IH@ 5DH=In=JH@HJtHJH#H;J@t@DŽHD$pD$pH@HD$lHPHD$dH`HEHpHDžHD$l,HDžXt$dHDžhH}HDžxH HD$(H<H ID$  IL$HDA@ L$\B2HELT$P\$DMʊHL@ @#IC C42DT$@EbID$H;H8TB8<0u݋D$HL$hHHHH u @=v@HUIψ\$LI= IH@HIHIH#H; IHD$HD$HH@HD$DHPHD$@H`HD$PHpHDžHD$D-HDžXt$@HDžhH|$PHDžxH HD$(HH ]HD$ X@8 qIDE3IH@ 83H7II@IH@03,DLH;HHM ]<IL$XHtHU 辿Ht"IL$`HtHU 覿Ht ށrMHcD$`L$hH@8|$LtHH#ںXHH غIEE3IH@ J2DL$\H>DIHD$xDh=GH@H GHGH#H;FHD$HD$HH@HD$DHPHD$@H`HD$PHpHDžHD$D.HDžX|$@HDžhH|$PHDžxH HD$(HH PFD$ KI话2'9D$\BD$\3+t$hމ\$ptIL$HE3D$dIL$HE3։t$pɷD$dwIEE3IH@ 0HK5IcHcD$`L$hH@8|$LtHH#ںXHH غIEE3IH@ v0DL$\HF<DIHD$xIDh貜=7E-H@H0EH+EH#H;!ED$D/H=HD$HHDžxH@HD$DHPHD$@H`HD$PHpH|$PHDžh|$@HDžXHDžHD$HH HD$(H tDD$ o^9|$tH|$(LD$XE3@t$ HT$dIY$IEE3IH@ &/H3IIEE3IH@ .DD$`H:DD$hIDL$\HD$xIDh0=CH@HCHCH#H;C}D$D0HyHMXB8ID$HHU\$dHMPMD$0M̉\$(HD$  DE3HMID$XHEHtD$MID$`HED$M H#HzI9|$XoID$`H]DAHKHDd$D AԍHEDHH`DHHH;bH]9|$ttRH|$(LD$XE3@t$ HT$DH"1HK`HHH@ _-u I跙CDd$DHKh$ADd$(LeMID$HMD$0IT$hIL$`HD$ ^IL$`HHH@,@AID$`D;}.@8x0tHH@HH HtH HtHIHHcHHHt D@8 HM誺\$dAL$MMHEHIEE3IH@ Q,H0IIEE3IH@ ',DD$`H7DD$hIDL$\HD$xIDh[=@H@H@H@H#H;@D$D4HH $D$0 AHD$(EH4Dƺ<HD$ IIEE3IH@ O+DD$`H7DD$hIDL$\HD$xIDh胗=@ H@H@H?H#H;?D$D3HHD$HHDžxH@HD$DHPHD$@H`HD$PHpH|$PHDžh|$@HDžXHDžHD$HH HD$(H E?D$ @;IAEE3IH@ "*H.IIEE3IH@ )DD$`H5DD$hIDL$\}HD$xIDh,=>H@H>H>H#H;>HD$HD$HH@HD$DHPHD$@H`HD$PHpHDžHD$D2HDžX|$@HDžhH|$PHDžxH HD$(H>H =D$ 3HDB z HU HM艼I%==H@H=H=H#H;=D$D5HHD$HHDžxH@HD$DHPHD$@H`HD$PHpH|$PHDžh|$@HDžXHDžHD$HH HD$(H <D$ HEHMH AHM0HM} HMu fAfYIL$`Ht(9|$tt"HHH@ r'u Iʓ\9~)@8t HHEpHtHHtHIHϊD$MEHMHuEIyH .D$0HD$(EH0Dƺ<HD$ IQ3DB i H~5HM90uIH -D$0HUHMFuWI=k;pH@Hd;YH_;H#H;U;BD$D7HqHEHMH .8 HMͽ' HMl } HMu fAfY9~2@8t HHEpHtHHtHIHH HϊD$MEHMHu!IH D$0r3DB HHM.u!I谑H eD$02HUHM޸uWI~=:H@H9 H9H#H;9 D$D9H THEHMH ƻy HMeh HMW } HEufx@fx|$l|$DL$@Di»A ID$HD;h8 AB840@HMPILHED$MEMD$pLeƋT$dDD$pIL$H3;D$p&9|$ttAH|$(LD$XE3@t$ HT$dI8HE`HM`H@ #HM}7iD$dHUMD$0HMPD$(MID$HHD$ :HE`HM`H@P# \$lC;}6@8t HHEpHtHHtHIHHcD$@HHNJL$MMHEHHMP@8LHED$MEMu[I)=7 H@H7 H7H#H;7 D$D@H\$lDL(Hw*HHM+3IDB HUHMܵ*HMHM边HM]} H]u AfCLeAfDkIL$HD$hAt$lD$@ CIL$HݡD$DL$@D(I IAEE3IH@ c!H%IHcD$`L$hH@8|$LtHH#ںXHH غIEE3IH@ !DL$\H,DIHD$xIDhL=5 H@H5 H5H#H;5 HD$HD$HH@HD$DHPHD$@H`HD$PHpHDžHD$D=HDžX|$@HDžhH|$PHDžxH HD$(H^H 5D$  Ih=4H@H4H4H#H;4D$D?HD$HHD$HHDžHH@HD$DHPHD$@H`HD$PHpHDžX|$@HDžhH|$PHDžxH HD$(H *4D$ %/H AD$0zAHD$(EH(Dƺ<HD$ I^IEE3IH@ DD$`H*DD$hIDL$\THD$xIDh=3H@H3H|3H#H;r3hHD$HD$HH@HD$DHPHD$@H`HD$PHpHDžHD$D>HDžX|$@HDžhH|$PHDžxH HD$(HH 2D$ IAEE3IH@ H"I7HcD$`T$hH@8|$LtHH#L$XI DIEE3IH@ MDL$\H)EIHD$xDh=2cH@H2LH 2H#H;25D$HHD$@<|$dHD$HHDžxH@HD$@HPHD$dH`HD$PHpH|$PHDžhHDžXHDžHH HD$(H S1D$ NI譈=21CH@H+1,H&1H#H;1D$HH8D$DB@IN=0H@H0H0H#H;0D$HHD$DAIH D$0AHD$(DHr$<IHD$ RIAEE3IH@ *HIHD$xDh=/vLH@H/t9H/H#H;/u&D$HH D$@;t$dADd$lED$AD;}4@8t HHEpHtHHtHRHHcHHHt D@8 9|$tHE`HM`H@ AuWI虆=//H@H/H/H#H;/D$DCH$,HT$xD$L؋D$DB D$piDbBrD$LɃgHcD$`DD$hI@8|$LtHH#HH IEE3IH@ kDL$\H;%DIHD$xD9htpI袅CI蕅=.H@H.H.H#H;.D$D:H kI>=-H@H-H-H#H;-D$D8HI=l-qH@He-ZH`-H#H;V-CD$D6HrI萄H ED$0EHD$(DH!<IHD$ hIK9|$tt<rIL$H;Y8sB840uuފ\$LɃNɃNHcD$`DD$hItHH#HH IEE3IH@ RDH`IHD$xD9htpI莃I脃@@@@@@@@@@@@@@HΨHMm)HM d)HMP HMb*@HH3H$HİA_A^A]A\_^]H\$ UVWATAUAVAWHl$H`H,H3HEP3HT$XIH]H\$DHD$pLH^DKHD$x5IHDCDH@ HH3H5a\$@XMIMH\$PD$HDs̍{ADAED\$LMMHA;y8DDDArnE;A8shAAP< u1II0AAAH Et <AIA0uH uE;s EEAE(AuDwDDEuAHL$pNtIM0LL$pEEAhD|$DH9]DDED|$D~eHALHT$`HL$pxDAuE+3IMHDAADADPEAH;E|D|$DD$P3Dt$@AĉD$PkdAt$HA;DGADt$@ft_D\$LAA2H kAD$0HD$(<HHHD$ EA'du Ht_PE;HAE3HH@ pHH=J(H@HC(H>(H#H;4(HD$LD$LHEHD$HHE HD$@HE0HD$PHE@HED$H*HE(Dt$@HE8H\$PHEHHEHD$(HH 'D$ HA6HH@ EAHHHG^Et Lt$XA~tAFDAAHL$pyqHMPH3H$H`A_A^A]A\_^]H\$WH LI0HAADAPA u4 RAFHAB t AAAD AuEA EAA u4 AFHAB t AAAD AuEy EAHDC@H֜H\$0AH _@USVWATAUAVAWH$xuH+HC'H3H`LL(3D$dHHD$PH8HEH=HHYHL$XHHDL$tDD$pHT$xL|$hH\5HpHyHpHH|[HxHHHHZHH0HDHHH0HZHHH0H0 HZH8HHP HHM`胗H GHFHdH}8HE(H HVHE0}@H}H}P7IL$0HHEHYHEH}}HH@(HU3ɍwDwIHID$pH+I$J 0II$H@pIL$0HH@yLHu#IEE3IH@ IIL$0HH@~D3I LAID$0MDIHHHHH@ 8LL+uIL$0HH@3M͋DƸID$0HHHHH@  I@z3EF0HMiHM HEHMHEHEHEHEE[CAIL$0HH@ DAD$pDDl$`E;v'IL$0ED|$`HH@J 3AD$pDHHI3L AtHL$xHDDLmHhl{H\$hEE3HHH@  HHNi@HM@H"H H +HM("HDHDHM`QHHP HH0 HH0H0H<HHHJHHHgHLHH]HHpHpCH1Hj@H`H3mHxA_A^A]A\_^[]HD$PH9xx~aLt$xHLl$PLHUInHHIHI;}!LEHHkLHImI;Ex|Lm3DwLd$xMIHv-HI39|$du*H\$XHUHK0HH@( HK0HD$dD$t3ҋ\$`EEHD$XHHtMH9tDLHIJD$d3HL$XHHEHHUHD$XHUH]HtgLMt L;LHtMHL$hEE3uHH@  HcD$`HL$hHH+HLIHLpHD$XHH0HHHH@ 3ҸHL$XHUHI0HH@( H9}BH\$XHUHK0HH@(b HHVUUUUUUUHHH?HHIHHEmHD$XHH0HH@$ HUHD$XHH0HH@( HHHHH\$X3H9}@t$`HU H\$XDELMIDd$`3ҋD$tHK0AA3DEMA$LEAHIHE HB(HUgHHIHHH#HHHHHH pD$TA3A3DEA$ALe3ҋI܋D$dH+HM(D$`I+t$`HFH]HED$PLD$tHM(DL$p0HL$HHM`D$@D$8HEt$0HD$(HD$xHD$ HD$XL@0XL|$hE3E3'IIH@ PH It3H`AL|$PH L`HHf9HFGMHAArHf!HE3HE3IaXDE;JH0 HM`詈4E3H0 E3I H HE3E3'HH@ H*HBH\$X3HCpfHAHCHCpfHEHGHK0HH@hHS8HKpDHCpHNTFS HHHK0HH@5HK0Dt$pfCxDszf{|@{~1HUfHfLf@3ɉHCpfH&HCpfHAHCHCpfHEHGHC00 HCp@*΀ဈH&HK0HH@(HUHHCpHHH(HKpHEHA0HpHKpHHA8HK0HH@?DD$tEA;s;wHCpوH@ HKp3AA@A;sϸ;wHCpوHD HKp3AAD3\[HKpAHHCpHHI[HKpALHCpxPHHXHhLH HPVATAUAVAWH$@DHAD"D@`IDDAE"A D$pAAD"A "A $$tS$v4IAE34HH@ HjH2$HN0 HN04$DtcHN0HH@A;$tEHAE33HH@ sHN0HH@bAHoHD#;]H$HH$EHL$`Eɋ$A H@hAH\$XD|$PL$HL$pDd$@L$8HDl$0d$(D$ L$I[0Ik@IA_A^A]A\^HUSVWATAUAVAWHH)pHH3HHLLHM@EEDUHEDMHU]IL$0H23HEH6HUHEWHH}HEAH6HEHHEH7HE}H}Љ}؉}EHE H}0}8H@(H}H}}}HHHH t*E35IAIH@ HIL$0HUHH@(^IL$0H8H+HHHLHH@6D;sIL$0HH@EIL$0HHB `;sIL$0HH@I$HM@3A@|$(E3E3A׉|$ HE]E3u 'HEL-(AHtAHMH%u<IEϺ IH@ hIIIHUIH@8IEA A;υt(HU;sDAfE;H;rIEE3-IH@ II臿DMHEDEHU@HD$xI̋Lt$hD$`D$XD$HxD$@pD$8HEHD$0hD$(t$ \I$IIH@p\IL$0HH@B3Ҹ tHM TMD$0GLˉD$ HUHM"30ID$0HHHH@HHH@ED$@IT$8D+HM HEHM 3IE3EτIIH@ u8IEE3 IH@ aIIE3CIIܽIL$0HH@&IL$0D}DHHB HUHuHM@HLMHLEH8HEHD$(HEHD$ ]5WH*HyXHEWH*HyX^LHZfI~IEϋUE3IH@ `LIHkIcWHH*HyXHEWH*HyX^LHHZfI~IEϋUE3IH@ LIHp+3IEE3'IH@ IIF@HM2HMHM@XHH3S($HA_A^A]A\_^[]̸H\$Hl$VWAUAVAWH HMHL$hE2XLL$hIMHA}9LL$hTHHHt7HL$hfff$H@ tFHf0F DnHN(H[HSHHt@HL$hH>ggg$H@ uGHg0G DoHO(3HIHIH@7t%IHIH@ tH3D3H{3HtGIIHC +I΋HCHH;u!IIHC +I΋HC`HtXIIHC +I΋HCHH;u!IIHC +I΋HC`vHHHeHtLHIOH\$PAHl$XH A_A^A]_^LD$USVWATAUAVAWHl$HxLMHMLAU0HINX3HD$hHf.HD$pIEHt$xuHuu@fQIEf9pu<r7ILGu H ADFD$0IHU@IjtHMt D D@LHuEtN9u`HD$hHD$0LL$`HD$HHD$(LD$DHEHUHD$ HMaMD$D)E3E3IIfLHqAL$ D$D+) +@tr+tS+t1 PA>FIxLH`I (Et H9t$`t I9t$uIAIN`LHs`A>IHLgEH cHDD$0OHD$(<HAHD$ wI^HIFPIfxMFHRJNA>Et(IiLH2xHDxLA|$HE|$MMG@L;j/~ L\/IH=J/IE4EAU0IE0H fD$TIET$PT$XHfL$VHD$PHH0H fL$\fD$^I9t=AI LGu?LD$XLL$LIA蜜tXD|$LEtAI LD$@Ct6DA^DuIxLH^I @HL$hHM@HxA_A^A]A\_^[]@USVWATAUAVAWH$HH)H3HILL$hHH\$pHMMLD3HHD$xH#*HEA9GEo0H}}H}}Ht#LL$PALD$xZ sDd$PDA0@|$PLD$R|$THU|$ ILuD$tfA9F0A9'D$vfA9FEPD$(LMhAD$ HL$xA~@v AF@DDžt&LE@DIHM@I+DD BfHIIuAHU@HMhf|E@HD$hLDiHEhIOHMO0HD$(HE@HD$ HNHH|$Xf|$@MHD$8IHD$Q@|$0HD$(ED$ Dt$PHtaHFPfBhQADt$PGHD$hLH\$(iIOHIMO0HD$ H´HH|$`oDt$PD$TLD$RHUA0D$TIωD$ HEuvLt$hEugULE;A@|$(OE&AT$ HL$xHƅ-HItHt HFPfF$hHL$xmHM$@HH3覽HA_A^A]A\_^[]HHXHpHPUATAUAVAWHH@LMHL$`AH贯E3HL$`LˋEE袱uH ҺD$0,A]HL$`^HL$pDcY=IFPHL$`3DfX UuH qD$0<(HD$pfD `FuA;tE3HL$`E33HL$pHEE3D$PH L!d$HfD$TAfD$VLxHL$`Eċ贰HL$`J]AE8A KA t AHL$pYIFPDHL$HfHL$`AZHD$pf HF;QfA DfQֹfHLAIiALyiI蓱QtfA DfQֹfL^EIE̺yiLIHMHHEH"t LrLIҁ{i蛝HEйAf HfHEfHLoDI AEu#D;tE3HME33bv\$THD$hLD$QL|$8H0Dl$0HMLd$(A HD$ v3LL$RMHU3uH pvCD$0y |$RtAAEu2D;t(A|$8tIT$ 3E3HME3\$THd$ LD$PA0HHMHHHD谪HD$PE3HD$0LHD$XHD$(H0HEHD$ oYuqAչevLuHDIHD$ 莚HELD$XH fD$\HEHfL$^H0LL$XYc\$QHwuHMuH uޢD$0A|$8IL$(tML$ E3ɋEHUH|$pHT$8HUHT$0DGzHW0D$(HL$ HRAչeLMELIωD$ 蛙A|$8IT$(tIL$ 3ɋELEDOzLD$HLG0D$@D$8D$0HT$(3HL$ HNUAEu"D;tHUHZAEu-D;t(A|$8tIT$ 3E3HME3AUHEHXHHMZuH sVD$03A|$8IL$(tML$ E3ɋELUHT$pLT$8LULT$0DBzHR0D$(HL$ HP[AչeLMELsIωD$ A|$8IT$(tIL$ 3ɋELULD$pLT$HD$@EHzM@0D$8D$0HT$(3HL$ HSt&AEuBD;t=HUHcYu$ELMLD$ fIlAEu D;tE3DA|$8tIT$ 3HM;~U;tuvH q踟D$0"HL$hDMA lǁ HEAՉ\$Te耈DMLqIHEHD$ 蚖AEuED;t@A|$8tIT$ AEuD;3E3HME3H}HEAHD$ LD$PHH_HMu8D$Pt1H p躞D$0;HT$XH\HHGH.qHMyuH puD$0HRHD$hHxHHxLH>MHMLAuH Op"D$0uHMtALUEJAutfAAչffEJLaDILL{iI?AEu#D;tE3HME33=\$THD$hLD$QL|$8H0Dl$0HMLd$(AHD$ QLL$RMHU3u@H KoD$0HD$(AHDú<HD$ I۔|$RtWAEuGD;t=A|$8tIT$ 3E3HME3bufLI^DDt$THd$ LD$PA0HHM誾+HHHDIHD$PE3HD$0LHD$XHD$(H0HEHD$ RAչe LfnHDIHD$ #HELEH fEHEHfMH0LM/Ru(HDLnHD$ eIȒD\$Q|$Qt]AEu[D;tQHH0dTt'A|$8tIT$ 3E3HE3ufjEHD$hH\$Ht$UWAVH$@HHMHAHgHd$XHd$`HMHd$hd$pHD$HH~HD$PFHMPwH{LCHLϋ uH hl;D$0H=HHL$HuH &lD$0HD$HALHD$ HUPH u ^8HO(tLO E3ɋ HT$HDHT$8HHT$0H(D$(HL$ HMHuH kVD$03HM~LDHT$@HM褃H9Xh F9]uS}uHUHMÄt8HHMQt$8tHW 3E3HE3Nu=H j芘D$0+HD$(AHDú<HD$ IG2HMPHMEHL$HAH5L$I[(Is0IA^_]HHXLH L@HPUVWATAUAVAWHHLMHMMHHMPHgH (3HMWHEIω]A\$PLD$QH\$ HUPEǹD$RDu18\$Qt+9@usWH iYD$0pAH\$ LD$QIHUoD$SȾul8\$Qt*9@u AuH &iD$0y5EMO0LPAƺ~iLHɉD$(L$ IEgEtLMAM;IH HH~,IG0LLHLIHD$ tjHMqE3HMHZHD$TH]EHD$ LHT$pHM u$LHLEMO0IκipD$TA;t-MO0L?Lt$(iLHIΉD$ :ULeHD$TIH]DHD$ LHMP- LHuMO0LiID$T;t%MO0L|$(iIΉD$ L-Iԉ\$XHT$xDDӉ\$hDÉ\$lnID$ H;=AL$AD$E\$ADDL$XHDMAD$DD$ltDDT$hD;wzC8\#usA9 $uLL;rMI@t$PcIAE3iIH@ ٸA$H}IMG0DωD$ h;GD@t$PID;v#MO0i|$(DD$ L蓌ݒIAE3iIH@ SEL$IMG0IED$IT$mI@t$P萒IAE3iIH@ H|$xIMG0I+LI蜌LD$xHHHHE+HDHH;DOII蔌ANHT$Xt!MO0MʼnT$ Iκi@t$P見T$X8\$PD$h@fD$bD$lD$dfT$`HD$`H;D$p]׹e{EO0LUIL$rD$tT$pDD$bDL$`D$@D$dL$8IΉT$0}iD$(DD$ L)eH0@0GHD$TH\$(AHD$ LHT$`HM t%|$TuL8HMMI$H %dD$0mAHD$(Dƺ<Ll$ I載H c近D$0HHL-1HD$(ADLl$ <x@=IG0LLHiIHD$ L0L8H(@eMzEO0LIpAu8\$RtEHtH9tHT$xHMPHH)GMHMPHE3E3Iy8\$StAHtH9](uHUHMwHH)GMHMHE3E3I2@L8L8L0Gu tA8]tE3E3IIt@HMOHMPHMH$ HA_A^A]A\_^]HHXHpHPUWATAUAWHH LEHMM3H<HD$`HM@HHD$hH\$p\$xH]]VH#HL$`}uCH ayHxHD$0DKHD$(DCHT$ <30AH\$ LD$@IHUj H}H@v{HxHHAE3iHH@ \MG0H-HHAE3iHH@ +A@LH+HÇHsiHxHeHAE3iHH@ ۲MG0HHxHAE3iHH@ AzHD$DH]AHD$ LHT$HHMurHxHӌHAE3iHH@ IMG0HHHAE3iHH@ HH蹆|$Dt}HxHZHAE3iHH@ бMG0HHmHAE3iHH@ DD$DHAH5$L$LAHHEH;uD$HAHHEH;txHxH讋HAE3iHH@ $MG0HHHAE3iHH@ DD$LHLH苅}|$HBHxH+HAE3iHH@ MG0HrH>HAE3iHH@ pDD$HHH NHHD$`9]LUAԹeLDtDMLHAG0D$(LT$ A8]8tME LHHMtpE3E3ItYHpAD$u'At!A8]8tIU HE3E3ItHXt ǀHM@ HL$`HML$ I[0Is@IA_A]A\_]H\$DL$ UVWATAUAVAWH$PHHMHMLVHL$@DCzHL$@HS0E3IE3fDt$8ELt$0D$(Dt$ Du$H k\>HEFD$0 IH^LIxLHH#'HMML蜀xHM3-gHEHE3HME3erLLI辀E8u8tME MHUHL$@guL@eI胀Au;t6E8u8tIU IE3HME3uLeI8M8 M LI2t=HH;D ItEtAtADHL$@GHM~~H$AHİA_A^A]A\_^]H }ZPDD$0 IHD$(<HAHD$ DL$ LD$USVWATAUAVAWH$8HHEHMH|HL$PE3AED8f8tHNIHI^0HH@ H`H\$H3҉HHDd$DH@HHHAչewpLOLH0~OLGA ȋGLcHMI L }$HMx*3Ʉ9Ou*f9Ou$f9Ouu9O8u8N8tLfWLRDOHG LHD$ HT$PHM3Ʉu%8H X藆D$03 cLd$PAL$XGPDo`D+D;DGAALHD3HQHcHD$@LHD$ LGPEII38F8tLN LLG`IHWPD$0D$(H HD$ uhWLG E3HMo3pD(AEu,At&@8~8tHV HE3HME3?IW(AH_PI$HL$@3LH|$(EHL$ IH@8ItQD9l$@uJ@8~8tLF LI$HUIH@rt"@8~8tHV HE3HME3uH VȄD$0 =3ID(LH\$HDd$DEAH V艄D$0n H0AHD$(EH<HD$ B|H rVED$0f H \V/D$0Q H0AHD$(EH<HD$ {3DQH VH0AD$0! EHD$(<HHHD$ {3DMtIHL$P^HMyAHA_A^A]A\_^[]H\$UVWATAUAVAWH$@HHH3HL LHMLL$HMT$@w3D$0HH]HD$p{HIHD$xsHAt$({HD$ Dk]DH]Eʼn]z=ivaH@HftNHeH#H;[u;HD$Dft$DHLHHD$(HcH |$ {AN4A8^8tIFHH@XA HHAIύpDH|$`Ht$hc DLAIrDcAuA8^8tINHLH/AW0HMML}xdHM%SHE9X f9X$f9X&HEI A8^8tIV HDL$@HD$PLD$HHML|$8HD$0HD$XHD$(HD$DHD$ ot4HD$PH9D$X}eHT$pHMuHL$pA3.3&HT$pHMuHL$pA34DHD$ L>SI xLL$` EI DD;l$h ItlAHqeHD$ EAE9O0I H rRED$0 AHD$(DH<IHD$ x@HL$p HMv@HH3FH$HA_A^A]A\_^]Iw@USVWATAUAVAWHl$HhHhH3HEPHeHAHEHdIHEHHLL$HLEA~LHL$`Dt$0E~DDt$(EHD$ {HwD95Ѹv\H@HθtIH ͸HH#H;u7eLHD$@HE@fDt$@D}HHE HD$(Hg`H ||$ ;xK8tHC3H@HD$ptL{ E3C0IωD$DHgfffffffIoL|$XHLHI?LHT$h莠E3IHL;H\$hA~ LËLOLE3I)IG3_Hz3H;ZLLIItI;} HLM;g|Ld$`H&HMHcT$DLMHL$pLLHfdd$@HM/L$DDd$@HL$xAHELMALD$PHMSHL$PLD$xHHIIHMLHD$PHEHHH#EHIILM+MEIML|$XIDd$@HMDDd$@D;jLd$`LL$hLHMƺ IH#IGHH;Ht$H IA|$0uI$ AHl6HD$ HEAFtUH yNL|D$0 H cN6|D$0 HL$HAHD$(DH<HD$ s2HMHMPH3D~HhA_A^A]A\_^[]@USVWATAUAVAWH$HHHuH3HH0EL LL(HL$`HMpHD$XLD$h,pHMsA0IH}Hۉ}H#H}H}HD$pH+HD$xINHA~HÉ]H fEfEHEHH H0HH ыH H H H5WHnf HLHHHLHwH0HIHHD$pD$PHEHD$HH HD$@HExHD$8H!HD$0H` HD$(HHD$ H@HLHXH`H8fH@h艎L$pAuA;tHNHVHj7Hf!HL$pAuA;tHL$p;u~A$x ID$0HHH@(buoH /\HMED$02DHD$(<H?HD$ TA$H A;uLEHHoOHI$I9$b\$pI$^A$H DLHMePSA$HH A$ HG!H -[HMED$0DHD$(<H'HD$ SA$HH A$ dHx@|$z&DL܇HMeRA$H H I-[HMED$08DHD$(<HHD$ RA$H ^A$H HH ,ZHMED$0DHD$(<HHD$ vRA$H A$H A$H @8|$xt=CuuA;u+HML efQA$H H|3HDBHELHD$HL\$@HHD$8I$I$IHD$0HExHD$(HHD$ {uA$H ID$pHX(@8x@}H@U*IL$0HH@}IL$pQ@AL$zȉMHMEd$zHI0HH@}HDeDd$pHMHHMHHMHMxE(AD$HMMH] H]M@uDeukE;tfHULEL~3uRH *XD$0~EHD$(DH<HHD$ VPLeA$H HMLEH\$ HUuLeA$H HM0HH@(}|uRH "*WD$0EHD$(DHc<HHD$ OLeA$H 4E;LeuI$ L{NDD$pHULI$@uA$H L${LM@8}LPL$XI$HL$xfE*HL$PHMHL$HMȈL$@IfD$8HHD$0HEPHD$(HHD$ DWL$p@8|$xtMLLuLt$8D$pMD$0L#EHD$tHD$(HPHHD$ H#UH EzuA$H HUHH HHtaID$pH;X8tVT$pe*6L vIQDID$pLyL˺iIH@8HD$ pEID$pHX8@ƈD$tD$t\$pLMH EAEƋӉED$u`YCuNH LD$0EHD$(DHy<IHD$ IDA$H H uA$H ELLt$8HD$t\$0HD$(HMHPL#EH HD$ uA$H GMD$tEΉM;u}A$x uotkID$0HHH@(ouNH tKD$0EHD$(DHx<IHD$ 4CA$H LMAHpAuNH 7 KD$0EHD$(DHxx<IHD$ BA$H MHp$uA$H 'ELL$tLt$(LP\$ HHpH#UuA$H @8|$ttru;ukID$0HHH@(nuNH Q$JD$0EHD$(DHw<IHD$ AA$H gLMA Hp@uNH ID$0.EHD$(DH(w<IHD$ zAA$H HpuA$H @LjD${A;t{ELLt$@\$8HEHD$0HUxHD${ML#EHpHD$(HPHD$ uA$H fD${t@@t$|L$tL$tɋMEΉM@8}t A$;u}A$x uotkID$0HHH@(luNH nHD$0QEHD$(DHu<IHD$ .@A$H LEH ZEuNH 7 HD$0[EHD$(DHxu<IHD$ ?A$H MH $uA$H 'ELL$tLt$(LP\$ HH H#UJuA$H @8|$tEEƉEEHH#MHy |H0DƺLMMNjH=uNH 1GD$0tEHD$(DHrt<IHD$ >A$H GHuA$H !ELL$tLt$HHHD$@LPED$0TEHD$(DHIl<IHD$ 6A$H ;ukID$0HHH@(buNH l>D$0uEHD$(DHk<IHD$ ,6A$H A8$t%E9$ tA$  _A$ 9}tE9$ tA$ A$ HMtg+t.A+t uqgWLfI΃utKhDCu A;tf$LfI@8|$|tgueILXf4HMA8$tD9)t1LuMA;u M$ L}IL$0I\$pHH[(H@aLcALILIH =IH}I#L eI H#L 9fI4HMPHtJHEXLHЉL$ H IρH}I#L eI H#L :fI3HM`HtJHEhLnHЉL$ H IρH}I#L eI H#L ;fI_3HUHH AHc]L HML8LIH =IH}I#L eI L fI2DMMǺI2DM@MǺI1EMǺI1@t$zLeDt$pHELscjHDx@D|$|2H]HpHA 3HAH CHHHXHHHHPHH@HHHHHH`hHpx*^HED+Ʃu^@8|$|tWD;tAuLHqtDHLl$0LHD$(H`#H HHD$ M$ILEPED;uID$0HHH@('ZEtiI$8 HH@(ZH H|+HmHPdlHXlHLlWH@HBf0HH HPH`@X\mHX詸H蝸HLHH*HP臑H{H` H!HkHkHP?HPHg*HH ?1HtOHH5*HLHpHp*HLHpHp*HMH H )HlOH H )H`#~WH}HfEH}H} @}}H]FHpkHnHH&HMx͋H1H%D$zH)H35HĨ*A_A^A]A\_^[]H\$Ht$UWATAVAWH$`HHmH3HLH|$@33L҈\$0RIBLMA@0D{D$4DcI@0H fD$8 I@D|$(D$ HfL$:IHD$4HD$@AAGLjUAEcHt|MHD$0HD$(LD$@HLt$ UBlu?8\$0uEMDžtA+t A+u2]D} v ]EAA;rA;AENJ؊HH3$4L$I[0Is@IA_A^A\_]LI[IkIsI{ AVHp0LػH:I[؉\$XHICIH[MICHI[\$hI#DCIL'tnIIH@UtZH^HL$@^tEF@HN(8_8tLO LDFHDHH2HCHHCLc Dc(Lc0Dc8Lc@LcHLcPIHtoHKAE3IUt?H GAHHHHCPHEPHC@HEXHCHHH@MtI@HtLHILHMg_H$@H`A_A^A]A\_^]H\$UVWAVAWHHP3H1HELH L3HEIH]]H]]]0 H@ubDGPHWRHMWUtkHMDGIDOI L I GL 6t>ALE0HU@I@u0HHuIIH@@Kt @uIHA(IKHMK^H$HPA_A^_^]H\$UVWATAUAVAWH$HHxLHMLD0HAHH#HM3HC0HD$P@HHD$X@@@0H|$`|$hH|$p|$xH~IGHI9EHpIGIxME@P00HML#HM8HM'DO0|$ L@DHUHMPLeAL$A$H H I;MHukH]IE3M%f|$@HMHHHHD$8MH0@|$0HD$(\$ $W@80tAAL@A0Dt$ HUHMLPPtLEu@8~8tHV HHM@8~8tHV HE3HME3lt AƇ@HL$P \HMHMH$8@HA_A^A]A\_^]HHXHhHpHx AVH 3H8uHx0HHH#8Z8tHr HHHWtbE3HOE3HltL8t2HLHIGt'E3MHHktHx.utH\$0Hl$8Ht$@H|$HH A^@USVWATAUAVAWH$XHH}^H3HLHHM`DL$PLD$`HT$XEHMHxLnL0HH3H#HL$xH,MHD$hDqH9HD$pHMM8 tLDLHAHxHHHxD8k8tLC MŋHM`?HL@D$HH fD$LHEpUBHfL$NILL$H2tiHxHMfDl$8E3Ll$0D$(D@ ID$0RVAutHD$pHL$`BAAD_NIOpHA8HA0H  HD$08HD$(<HR9EAHD$ \eH  D$0AHD$(EH 9<IHD$ \E3L:@jIDHMAHMXCHM8OCAHhA_A^A]A\_^[]HHXHpHx UATAUAVAWHhHE3H#HEWHyMHEHH@DmHEE}HewHHEHApELmfELmLmLmLm'LmfDmD}/D8h@}H@EA%HI0HH@.HKpDczQ@DHMB!HspF@y AHK0HH@.N@SzKzHF(LN0LC0Dl$@Ll$8T$0HUHD$(L$ HMHM*t.MLl$ MHM>tAI9NX| I9N`HMAMHspF@y AHK0HH@-N@SzKzHF(LN8LC0Dl$@Ll$8T$0HUHD$(L$ HMYHMlubfL1H8MLl$ MHMgucfAI9NX|I9N`|HUgAIg`INXMcHHHHHHHHIF`HHIII9N`tIHLI(I$H;uHUgI`LL; tlIHH@(IE3,TH S&D$0H =D$0HD$(AH~5EǺ<HD$ HEHM?HML$AI[8Is@I{HIA_A^A]A\]HL@HPHHUSVWATAUAVAWHhH3HHEMHvLWHEw@}DH}HMEۀIEp@8x@}H@DA%IM0HH@+IMpEuzQ@DIM0A]zDuHH@T+IM0HEHB=+3H}LALIM0EHHB+HEHu_H HMoAD$0DHD$(<H3HD$ ;@HM@HA_A^A]A\_^[]HEHIEp@}}H9x(dHELuLmLeHELMgII0HH@_*HMgAEHQpH)EHB(I+I;}R(A+AHA0DLMϋHMHHHUIHH@)*L}I;LMgHM9F"yIyLyEfy0IDq*I,I L HMI;ILHM@8}HL;uLc]AIzIIEHILEHEM+HD$ ILmgIN &4D]AMzELMgMcMIHHLHHHHEIC+DUAIzMcMIHHLHHHHEIB@uIHHUIHMLHb@8}t6LEHEHMgMM+HD$ LI5LMgHM@}UDEA;sEHHEgLMg@zHIHMI;fHEgH@pL;x(LuLmgLewHME3AMzDHM3ҋHMU%Hu2DAHELMHD$ LEHMFHEuHH9]IMpH+EH;A0t H;A8HMLC3?MEpLKHHMM@0HM.]IFEEzLMIU0IH|$8D$0LcIHD$(HD$ DaMI,g=I9L$X-I9L$`"HUID"ZIL$XHHHHHHHHID$`HIIII9L$`tI $HLI(I)H;uHUIYIH;8I$HH@(IE3a&HLH L@HPHHUSVWHHhH}HLMHLEHHEHu`LM@HH]LE8HU0L;L}~LM@HLE8L+HU0LHH|$ kH]@H}H;HLH9E8KHFpx@}H@U&HN0HH@g%HNpQ@NzȉMHN0HHBA%vz3ҋȋEHHHHHE0H;mHPHH;MLU(HE8H+E0IRpH;B0u?HuHHYL3HNLE(L3HM@pM@0^}y@2H;B8kH;uLE(eeI@px@}@@؊U-IH0HH@l$LE(IHpApzQ@ȉMIH0HH@?$@HcHHu5HELH#MHHE0HHHHE(D@zHH0AHU8HLHHH@#LULc]M~iHEIL+Ⱥ3L@AxFu3AxIu,A8Lu&AxEufAx0rAH(A@*H H H;uMHKI;|}H}؋MIHE0LMHHHHE(HH0D@zAHUHLHHH@ #LMM~mHEILc]L+к3L@AxFu3AxIu,A8Lu&AxEufAx0rAH(A@*H H H;uMHKI;|}H}HME;E~;HMHHU0DHI#LE8LHU0HMHzLU( LU(H]@H;~>LE8H+HU0LHEHHLHD$ ILM@HLE8HU0z@@Hh_^[]HHXHhHpHx AVH@=cH 4H5>IHCMII3ۃHtϸHHH]}H@HyHEHHuEH H]]AD$0 HD$(<H?*IHD$ EAHtDHAHl$XH\$PHt$`H|$hH@A^Ht$H|$UAVAWHl$HHHHD$XHMH;hMHD$`MH,XHhH d$@WI!HD$8H0HL$0HL$0HD$hD$HAD$pD$x(4t~E3HL$0AP O4HthHD$XLLMHD$ H-@tKH} A>|>Ht$PHE@HHD$ A HME3ot}@ u> r HFIA>@2HL$0Q3HMWL$@Is I{(IA_A^]HHXHpHxLH UATAUAVAWHl$HE3HHD$`WHiLHD$hHMH, fD$pHEA^HOgIHELLuLuLuLuLuLufDu]DuE{VHEDt$@Lt$PD0Lt$Ht;FHM2MupAF@y ȋ!IM0HH@tAN@AUzIF(MAMzE3Lt$8T$0HUHD$(L$ EN HL$`=!HL$`LMLt$ MHL$`LL$PILD$@HL$`Dt$@Lt1EtRLD$HIHURtHD$HH9D$PAEEt!E3EtH =D$0!E3t-L!eH4Hu0LL!wfHLIRuTL!eH;H D$0!HD$(AH%Dú<HD$ HAAHM UHMT0HL$`*L$I[0Is8I{@IA_A^A]A\]H\$ UVWATAUAVAWH$`HH2H3HHIL LL0HHEE3HIHEHHEHHEH8HD$hH HHZdHH\HEHHEH~fLD$xAHU3HL$pHMHELMLmL0HfWHELHLd$(LHD$ IfEHDuDt$dHHDILuH@H1HEHHuAH D$0R"~HD$(DNH$DǺ<HD$ IQ2M3IHcHM:IG(LHL$hLMLl$XD(HL$PHMLd$HDl$@HL$8HL$pHt$0HD$(HEHD$ qHD$hLMHL$pLHD$HIHELd$@Dl$8HD$0HEHD$(HEHD$  u8QH޿H HtHHH#HL+u!HD$hLMHL$pLHD$0ILd$(Dl$ !u8H޿H HtHHH#HL+uHM˯LHupH D$0"AHD$(EOHK"DǺ<HD$ IgHH HtHHH#HL+u<HIH@(Ht=Lu@0HxHHI;NIN0DNjݪIIH@(HuLuHD$xMHMAHD$(HD$`HD$ EIτu|IHdH D$0"AHD$(DHK!<IHD$ jHH HtHHH#HL+u?D$`D$aIH@8IIH@(HtRLt$x@t$aHL$`Lt$(HL$ MHAqtII@ t$`H@(HuLu@t$aHuIIHi|$at"AEDuAtHL$x3jD|$dt&HH HtHHH#HL+uHmHMPEtXHEtKCt+H޿H HtHHH#HL+uHHM@2HM֪Hu@HH3\H$HĠA_A^A]A\_^]HHXHpLH UWAUAVAWHhH03H%HEWHO^LHMHEȍ~HL uHD$`LH2`HD$hHHEHc]HEEHufD$pHuHuHuHuHufu@}HuuHuuuHu A9HEIHD$0LMHD$DHD$(LD$HHD$PHU HD$ D$HPtpt tuA~Y\$TD$PH H I;^0tHLH"ymHM(IwpF@y ȋ IO0HH@N@AWzHF(LAOz3LExHt$8T$0HUHD$(L$ HL$`{HL$`_IFIV0H D@HD$pH@ HH f;A;F0H0fA;HLD$@Ht|H D$07#H oD$0)#HAHD$(DH<HD$ (@HM4&HL$`zHM1'L$0@I[0Is8IA_A^A]_]LL$ LD$T$SUVWAUAVAWHP3LDoL$(H6~Ht"H xHH A[HHHxHx HIHH&`}HHtAHf<Hff8HH\HFH~H~H~ H~0H~HH~PH~(@nXHHI]pC@y  IM0HH@`K@AmzH$HT$@H[(A}zEuH$HL$HT$8LIl$0H\$(|$ y3HHH@ouHHHHFH@htH$L$L$$HD$(H$HD$ {HN@itH\HH9AHOAH$H\HH@Ht'DID;$@HPA_A^A]_^][H ƾH$AD$0#DHD$(<HHD$ QJH RH$AD$0#DHD$(<HHD$ HtHHH2MH\$WH HHHHH HA(HHHHH@(8HHuHHHHHH@(H\$0H _H%HLH L@HPHHUSVWATAUAVAWHHHLWH E3HEHEL5+HHMHEL%H~ZHHEH3ZDHM3HMhHE`ILmDmLmDm LmDmLmDmLmDmfDmLmLu0LeXHYWHE8HHfE@DmPDl$\H@0HD$hLHuHH lD$0$H0L%AHD$(<Ld$ EqE!8yHHt9L0HN8L`(LH9Y3HF0HXHFLnLnDn IH HŢ HM0财 C0L%6D$xAHC0H HEHC2L!mDl$P\$X@fD$RHHEHHD$0LMHD$THD$(LD$|HD$`HUHD$ Dl$|At2At)H 3A3A:CtHHx0AMމ\$XHHMH}H\$`f9L$duy;\$xusL$Rf9L$fugLMJE3E33I̍HD$pHLHMHHP0G!HMD9)y3IIH@8 IIH@( LHHH0H@H f;L$du7A9_0u1L$ff9Hu&H@ HH f;Mu;D$xuH0f;D$R&HL$hHHAH;uCD$Tf9Au8HUHMHELEL+B +uHut,HT$pE3E3I袌HD$pH3HD$pHD$pHYA OH}E3D8ot L9oHHH@  HHM0N8hvHHtJH3HHN8H]AHF(HUHF0HUHFLnLnDn IHHry(uHHt(HLkHHUHCDkfDkLk IHHHLD$pHP0HHHH@u L|$h\$XDl$Pf(eH0LEH@0D$ Mu1DL$dMċúiH0I HL D$fD$ WH|$pH0u0IG0LTL$TEHD$0iL$(HH|$ MO0LiHHE3Dt$\D9t HUH胵HHH@(c HE0HM0H@0Q Ht HHM0H贝HM0裝HeEL|$h2ۉ\$XDt$PH ~H0AD$0T$EHD$(<Ld$ >HL$hAHHE3EHM0HMHM!HMAHĨA_A^A]A\_^[]H H0AD$0$EHD$(<Ld$ HL$hHHA)HHH@(HAHHHE0HM0H@0H9HHM0p(H WH0AD$0$EHD$(<Ld$ HL$hAHHH]HHFH $D$0$AHD$(Eƺ<Ld$ HHL$hAHH3HHHA!iIAIH HHH@ HHM0ƛutH ^H0AD$0$EHD$(<Ld$ HHH@(HAHHHE0HM0H@0vE3yHtL7HM0跜HHu8H H0DKD$0$EHD$(<Ld$ HHH@(LLH|$XHpHEH0H MLHH|$HHL$@HL$PHt$8HL$0HHL$(HL|$ Ct&EuD8l$PtEHHH@(lHu8HE0HM0H@0SE3Ht HHM0HHH0HAHHEt\H8E3HtD0Dt$\(Au5t0HI3XuEO0L eHHE0HM0H@0Ht HHM0'D$\H DH D$0 $vHLH L@HHUSVWATAUAVAWHHHKH H@E3HHEHEXHEHEHE(HHHMHMPH@0HMHMHM HLDLDLuDuLuDuLu`DuhLupDuxLuDuLuDuLuDuLuDuLu0Du8Lu@DuHDt$`D7QHELH| HVHM d IHA(IHD$pHAHuIAIHm HPLXH0zt9LBMt0JHC0D iHD$0L$(ILD$ L&D7LPLH(LD$hHLl$ I 4uYAV MH D$0~%HD$(AH= Eƺ<HD$ I tOA}0uAEL?HVHC0HD$(D7JD zjL$ IDvHFHUHHHH#|$hBuH CD$0%BHt$PH@8IIH@(\HD$XHsHUH3ɄDH@8wLFA8Hu.AHiEHC0L_HD$(L$ I5HT$XHR8JuJD iDE;t;JAPHC0ELnHD$8L$0IDT$(T$ iHD$PLHEQEuIIAHLZL;tFHK0EuMMAIBAQE HL$@L\$8D$0LD$(LT$ iaHELUL+DB D+uHuEtMJAPHC0ELHD$@HEHD$8HEL$0HD$(T$ iIH@D0H(LHL$XLD$hLl$ TttbA}0uAhH@LHT$XED0HRHC0HD$(JD zjL$ IDHD$XDpHD$XH|$hHD$PH D$0&H pD$0%HD$xE3LD$hHD$ HHLFE8HwHAzHD$PH@D8HuIHXHHI0HH@pHT$hHcHHH0H;tyH{0 u0HELU0L+DFE+u HEuEu E H@D0LNHC0HD$8HL$0IEAE HT$(iDD$ LiHFfH HHH0pzHH@HcHHH;\$xNHHHL$pHU H8HH@0JHD$hHuH D$0l&Hd$PHHLl$pL0L A]HEPIHD$0LMHHD$(LD$`HD$XHHD$ .IM9D$`yu3HAH9EAf9HE`LEL+B +uHuIL$0ID$AT$0H D@f9L$\u9T$XufD9D$^u IHD$P~HHH@8HHH@(HD$PHHP0HHD@0H DIf;T$\uD;D$XufD;L$^t HL$hHH@(Ht$hHD$PHt$hHHL$hAHHIUL ID$0Ht$xLXJD iHD$8H\$0Ht$(L$ IYH0L]MUILPA0HA0AU0H }fHAHHfLDع~f耿E L IHHD$(L\$ HFL}xtfH tHX@AM0Au3t.H\$PHzuDK0L eI:[Dt$`H D$0[&Ht$pH0H@8HNLC0eD$ D IIIDt$`@2H@8IIH@(HHH @tDs@{H(MH#thHUH;t?HCxuE3L@LMHΥtIIH@(^HHucH D$0&H D$0&HHH0XzHH@HHHHHHAIAIH|$`tYAtOEFH nAHXAD$0`%<HD$(HHD$ EqEE2HM  HM HM HMP HM H AHA_A^A]A\_^[]HHXLH L@HHUVWATAUAVAWHhH3H HHMHD$PMHBLHD$XHU?HEHEHEIHL$xHMIH\$`H@0\$hf\$lH\$pH]]H]ȉ]H]]H]]H]]H]]kHHu@H HMxDKD$0/'DCHD$(<HBHD$ KH4HMuH D$04'MME3Ɉ\$@E33IwLHHEPHL$PMHP0Ll$`M;u A} =LM`DIFIV0EUIE@E^0H fD$BEtLfD9Quf9Qu D9Yuf9AtADE;s'HD$BQDAHHM"AF0HT$xD$HIF0H fD$LIFHfL$NHL$P}eAMLHD$HxjEMHD$(L$ HMx9]HEUpL\$xMV0eLD EMLHMxLT$(L\$ 8IIeyL@t$@E3E3IIvLHtLmhM;tTE3E33IuHu?IFHf!HIIEH@8LHHHH@0 L8\$@tGHHt@0MpAutItMtIIHHHH@(wLHH D$0]'H D$0x'HMxAHD$(DH9<HD$ EN0L%HMxeHHHHHH@HM[HL$xQHMHHL$PH$XHA_A^A]A\_^]HHXHpLH L@UWATAUAWHH`IDMILH 3fELfEHELH I0IL AI L I IHI_p@8s@} K@V IO0HH@K@AWzAOzHC(LMHLEPHt$8T$0IHD$(L$ HYtQEE3IM ,HGf!HHEHHHUXHHH;JHJ0A+2HExLep@80IGpHX(@8p@}H@U'IO0HH@IOpQ@AOzȉMIO0AzHH@HMPLMHIL$HMXIL$HM`IL$ HMhIL$(MAL$4A|$0H}@AL$MHUPII'8tMHpHMPGu$tLD$`HpE3IDl$TA\$PLD$RH\$ HUDHPtdHD$PLHD$0HMHD$QLHD$(IHD$SHD$ tDd$PEDl$Q8\$SDd$PDl$Qa8\$R LÈ\$QHHMD,HELMH\$8HMD$0H\$(D@zHP0H\$ vHD$xAD0EtHED0GAAuD$XEÈD$Xt29\$TtEu'׹eEue艛LjH谩GAubt]IHMC tMHUIGu:E3H\$ L0IHM0MHUIG8]CtMHPHMGAu*Ld$`tE3HPMIgtpDl$T Dl$TLd$`EDl$T8\$XGE3HpMItE3HPMIALeHqe1H : D$0D,rH $D$0+\eLH%mH ˰D$0+0H 走D$0+H ̂蟰D$0}+AHD$(AHEƺ<HD$ HVDH04HM)HM HMP H HP,Hp AHH3bH$HA_A^A]A\_^]HHpHxDH HHUATAUAVAWH8HHMILkH\HL$` d$@LeI̦E3LI赦[~8Df4AtHF3H@XE3HH3AHHD$P@AD$LDE33D$H3;D$@t(DȉD$@LI9DD$L3AAu~8AtHN3E&AEHML΋_]HMQHE@x3HMHMSd$Dd$ ƅt~8HN(tLN E3ɋE0LUHLT$8LULT$0DBzHR0D$(HL$ H]tqIHWxt^D$DljD$DD$ ALHT$`HMi8u;D$HDHL$PdED$HD;ssDD$L{H 聭D$0-H kD$0 -HD$(AHDǺ<HD$ I(4H [.D$0,AdLIVu@2HL$` HAZHML$@Is8I{@IA_A^A]A\]@USVWAUAVAWH$p菳H+H]H3H`AHL$pL\$XH DD$PEHT$`w?HL3HEHpLT$xH}}NHLHHϠH<HHP HH觠HPHHH0}HEH0HSWHEEwEt@ƅt@DŽD$QDADt$TEu%IuIUpIM0HR(D$XAMzE3IEpMM0@|$(L$ H@(HHH H?$M}pI_(A8@} AO@!IM0HH@_AO@AUzAEzH MO0ME0H|$HH|$@HL$8HH\$0T$(A։D$ DHLHML#rAHA UHMAH|$ DLD$RHHOD, HD$hH0 HLHD$ , 9D$hDCHpHAML#\HpLDH|$ LD$RHPHpiE3HPHL$xMHD$xAHD{EHHH#HD$xHA(HHML#觟H;LDH|$ LD$RH0HL\$XA;v}EmzHT$hH HL$pHHI0HH@3ҋD$XA++AHH;~'D$PL7HL$`҃ⴁTfp6Ll$p\$X@8|$Qt:IUpIM0HR(vHL$`LFA f EΉD$ &D$Pt# s fHL$`LLL$SH|$ LD$PIHT$Q"@8|$Q@~HT$pHeHD$PH\$`L H\$0HHD$(HD$SHD$ @@8|$S8@8|$PtE3HH {<E3HE33@8|$PuE3HH :<HD$Q@|$0HD$(LHD$pADHD$ I4DHMAE3HMADt$THHP LHAML#HP xIAH|$ LD$RHHP )ttHHH#@8y8tHIHHUHD$TEHD$ LPt3D9|$Tu,HUHD$TH|$(HEHD$ L<Dt$TD;u\IE0HHH@(u@Ht;H hw;D$0.AHD$(DH<HHD$ HH vHExWHEHHEHHEHHEHBHEHoHMpHM@HMH0 HEHHH}P}XH}`}hH} }(H}0}8H}Љ}؉}E"HPHMp)gHU@HMpfIM0HUHeHUPHM LNH=HxE HEE @8{@tyHM%tlLD$hHHUؠtWLAL0 Hqt6DL$hH0 H\$0LEHD$(HHHMHD$ 'D;uIE0HHH@(bHPH0 #HM*HMHM@HMp\f/@@@@@@@H0HMH}HqHPeHP 虘HHHH3H HHYH6HpHp?HL$xH 6@H`H3kHpA_A^A]_^[]HHpHx L@HPUATAUAVAWHhHLAHMHd$ HUALD$@ILuMuEH s舡HMAvD$0.HD$(<HDAHD$ @EN AtA#;u A$<dIE0LL}EAHD$(D 纡iAIDd$HDd$ 聙}weEf EM0LcILeoGuEt@A|$8tID$ 3DMHMHD$(E3HD$DIHD$ Kt@E9D$Du7GuRtM} tGA|$8tMD$ E3IHM[ u%AE0LDMeIωD$ kQHd$ LD$@A0HUIA,H}ߋn/LHuH r֟ID$08/NHD$DDE3HD$ IHMV9|$DAF8L$HAN8A|$8D$PtID$ 3HD$(HMHD$DDE3HD$ Iu%AE0LDMeIωD$ ~\D$PE3LeOMAF8HD$@IHD$0HD$PHD$(HD$HHD$ Tt{E3MƋI'WuH pϞD$0]/HEW@0I/MwAt|E3E33IAuhHMgIE0H9Au$eB|$@tH paD$0d/_H9AueH9Auf H9A un2fL'IoXHEgtNFH -pD$0>/HD$(AHnDƺ<HD$ I轕I.@2HML$@Is0I{HIA_A^A]A\]H(AHu H,sH;u H"sHu H sHu HsHu Hs~Hu HUoHu Hs`Hu HrQHu HrBH ur Hr.:w4Hoo!H u HrH urHrIAH(HHXLH L@UVWAVAWH0HLcHHE2'J ILD$`uNX H~8uOLL$pE3HL$xE3N Jx EuH HHHHx Hl3HtNH u HDHcHx HHcHHLH HHHLHH|IkZHI ;p uL+ I}L;uL;u>LAoHN8Lj詒HN8L NLA臒*HL$(AToHN8LRqLL$ DaAHD$`H{ p EH\$hH0A_A^_^]H\$WH HcHLx L; MuIMt?HI3HL$0HHL$0H+K@HKHHH HP Hx H\$8H _HHXHhHp WATAUAVAWH E3HELhA/L%, H-  & Hx HtL9H u H9P M L 3IIH@HJHHt;HNHItIAAIH@HHHuE3Hh )LHt_INH2IH8HHHAHˢLiHYA IF8H9IF@MnHEnPMnXEn`MM2IN8AIIIIH@_IML~3IIH@H;HHtLHN HuHHt HwtIAAIH@HHHuE3HE3P'HHt:HۮHHHCH>HCLk Dk(Lk0Dk8Lk@LkHIHt8HtHKAHtIHIH@dtHIH 3HL$PHx HtH;t HD$PH+A@HAHHD$PHF@LH HP Hx MtIIHHtHHHֻHx H\$XHl$`Ht$hH A_A^A]A\_H\$Ht$WHHH$̋HL$ L IX0HHH@cLVNLL׈IH+ψHX3HH(;sHB0HHHrቷ0HL$ BH$uL$I[IsI_LI[L AEQ0IA0H ESfD$ IAES DHfEKHD$LH0I fEC$fD$&IC H H I HrEHytH;At8t tu7HH$HHHHH\$H\$ UVWATAUAVAWH$ VH+H$H3HH@LH HEEDL$dILD$h:(HzH[3HD$pHHfHD$xH]]a7H}5H 葉HHHpH`HLHx L HHPHELp H H]]LMH]] ^H[\$WHEL5HDHEHH HHHHH]]L Hp HLHHLHHLH\$RH)HHEWHLuHE(HeHE0]EH]8]@H?HH HEXWLuPE@ `AA A]`EhH\$\ADž EL=u?H dD$03DKHD$(DCH-<HHD$ IM0H !LHL8IL$pHI\$8ID$(HID$0I\$@AD$H߆I$P"A$HwI$HI$I$I$I\$A\$$I\$A$LM A@HH5eH;u HjH[H5H}HH>TtOHHSt8IM0HHRt HHuD$VÈ\$VAD$LL$UHEILD$THD$ HT$Q|fD$XDtAT$T@:T$U/Ett"fDtHHH@HukL1HćfDtBHD$QD$0HD$(E3H\$ E3It8\$QtL9JfH|_@A HHH@@tL\HE9]tLMHfLH(LPHI讄u/LPHIuLafH AHPLI~ AMzIEpHH@(HHHHPHL0IEp@@D$SyDȺA.IEpIM0Dx@HD|$SH@}AUzEADHHIL8\$S}AٸA&IM0HH@:IEpH@AEzA}zIHHIM0LHH@3ϸrIM0HH@޲AEzH MM0E3D$(H։D$ " IupH~(8^@}N@&IM0IupHH@AUzF@LN0HPAEzME0HL$HH H\$@HL$8HH|$0T$(։D$ ZHb0HML#DFH%H0~|H\$ DLD$PHHjgD HD$`H HLHD$ 8 9D$`(DO0H\$ LD$PHpH0DFHHML#OH/DH\$ LD$PHH藮E3HHL$px0HHH#8_8tHHztBH9ptHƇyH9tHOxƇxƇz0M HHIH#HH cuH ]胋D$04LHMxHD$PIHD$(LL$pt$ HPHt$hL)u:ADž ADž n8\$PcIASIhIHD$pLH(LM؊0HHH#HD$pHA(Y Hp 3H DB(諑D$TAD$UAHIp HIx H I H I H I HPI HD$pI H I HEI 0M MI HI(I0HH#I8I HI IEXHp IHpI D$dAHA\I`AI ADžHIPA` I Ih Ep HXHH@HuAXHI@HIhHKAXHHOH@HeIpHIx\$(E3ɉ\$ AI I Ip I\$(E3ɉ\$ E3II7 I# I qI\$(E3ɉ\$ E3IrLI( Hȵߵ1IX HUZĵI H:Z詵I H+莵I H[sI Hu[XIH HY=Ix {ILD$\IIqIΈD$WD3HMHHMH+O@HOHEt.0HLAIHH#H=LH}A ttt u'tsD$\ҁ:|LH}D~@EtU8\$VtOLD$RNH}@fT$Xu2LD$QIu!LǺIfH[}ADž \$REt;HMPLt.LEHHUPtHt$(LEPHLt$ gHHHtHMTHMHHHHO(HY^@HMHE8E@ EH 辽HEIHD$(ML Ht$ ktXLLHkSt5DMHHt$0LEHD$(HHHM(HD$ MIL H V諄D$04HL$hAHD$(<HHD$ EAe|L=IhHt=IpIhHt%IpMtOIL$M<$Ht 9I\$I$+I$PIL$pzIL$(IHMA \$WHMPH1HyHMǻH諺H蟺H蓺H 7HMLHP2HMiHp H`HpHHH !yHΚHHyHHHxHL$pSHH HH3H$8HA_A^A]A\_^]HHXHpHxUATAUAVAWHH0Hg3LD$XJackH ˋH]HMMHL$`IHM]LHEH]]D$PH\$p\$xHD$hH]]D$QHMPvH4XDHMpDH&XHL$`THHD$PLLMHt$HLEPHD$@HULt$8IL|$0H|$(Ld$ t/HD$TH|$(DKHD$ DHT$XHMt|$Tt8\$PuuHt$HHD$QHD$@LMLt$8LEPL|$0HT$`H|$(ILd$ t1HD$TH|$(AHD$ LHT$XHMt|$Tt8\$QuHMPvHMHL$`蹷HM谷L$0I[0Is8I{@IA_A^A]A\]H\$UVWATAUAVAWH$@HH"H3HH E3LHIL@HMHMHD$xLuDl$`LmLmLmLMHU~,HAtHXVLmHHHOVDmHEMHQVLmHEH$DmHEAHHELHHfE9,@u;GHIu MBAHHA͸ M E3LL$xDHEI L HP0uHv"HHH8LMHMHHD$HMH0HD$@H(HD$8HEHD$0HEHD$(HEHD$ ']AHMAJ=EHOBG@DEHUMaHd$pHtHHHW@HD$`HD$0HMHD$h3HD$(E3HD$pH\$hUBHD$ L38\$`HD$pHHHH As H\$hzLL$xDHEI L H΋P0`ttaHHH@tMHFD@AAuM;t=IH+HH=v+]oHt'D9nt!F+HH=AňEoM;tu6E9iu*E9iu$E9)uEu I<DۄuAIADQL$XADT$lEH+IH=X<3 I<L;t AL;]AAEoEu AHD$PqE3IAt$pHEHlHM;uoLHHLËHLË\D$pAHUL$hHtt HRuL$hHt$H;t@EoL:D$0DD+MgL$(LHT$ SjSdD$h]O+ugHD$HHH@H;t>MoLL$0LHTjHt$(HD$ dHD$H]OHpD$hHcUoHH H CHt$HLEHUwAHMW\$8\$0Ht$ ;t+HHUH8ALIHUAHMWLƈ\$8\$0Ht$ ;HAH`LHIuoH MAjD$0 XRjQjEoLHt$HHDD+MgLωD$ bHM3L.Lnt$pDIqHt$P]ODDT$lL$XLD$`HUgLL$HL;HMIALML+LHMLL$HMPDT$AF+EE+IEK L;s D8(uQHH;rHT$PHDEOAHAHEoDDD$@HAEDiDA(DAHQ0#M3I]pHL >LLjDt$ a]OH >HMo\$@oAAA++DIIL;ssD8)u HH;rdM3IoHLSDκLjLDt$ FaLL$HEtD;AB΋AILD+uLD$`]OHT$PE+AHDT$(ADt$ +ºPjHL 8L`H >3hD$0DH >hD$0H >hD$0A+LHD$(<sAD$(+‰L$ OjgAHD$(<+‰L$ NjKAL$ HL+ºMjL 8`LL$HHUgLD$`EoD8l$AIH+HH=wE+3IAWnHtcF+Eg\Ht`VHDHcVE3HH H (HD$`3+HDnHMHt A+EgAH|$PD$D]O/Htu F++H 8HMoAL}oD$D\$@t$DHT$P]AIAH &=ifAD$0 HAHD$(<HœHD$ ^HM.HM%AHA_A^A]A\_^[]H\$UVWATAUAVAWH$H HH3HHLwLE3HWHEHHEHHEHHEHHEHHEHHEHHEHHEHHxHHHHpH%HUH2wHM H HXHHZHHPHAL$HHpHEpHHH(LMLuH}DeLeLLLhL`LLLLHUhLexLHLLDe0fDe4fE@Le8Le`DeXHLLH L0L8HH7@H PmHHHDfDfLLDLDHLDLDHLD@ HI7H%v HMhe HQ H= H ) LAHIILmEDeHMEl$H+L9uuHMLDILLEH;HUODeHMHL$ DHMEt E9EHpLMLEHUHM H|$PHD$HHEHD$@D$8ED$0HEHD$(HEHD$ DeQD8et/AI@HxDmDmD(EHMDHHHE{hDe0WfDe4HfE@ELe8Le`DeX4HPWDHffDLLD|HhHEHMhHEPL}@HHEHHLH LMHE0HULHEHEHD$pHE0HD$`HEHD$XHPHD$PHEHD$HHHD$@HHD$8HEHD$0HEHD$(DmHMHP&D8e3tHM볊]H}HMLMHUHL$8HG8H|$0HD$(HHD$ HMHG`LMHUHL$8H|$0HD$(HHD$ l[HEHG0HE HEH]D(HED(AuotjD8c8tHK ILUDMLEHUIHL$(HMHL$ IH@8tE9Et!H}HELeHD(SWHMDoD8tBD8c8tLC MHHUH@H}u먋G(tHMH}D9!uH}HUEDE BD BEHBDEHtL}LMHEH+H;|H+IHH&UH n2[D$0rHMEH N2[D$0g޺eLwHRIEċCLuEHED(HED(E8f8tMF MHuHRHHHH@(~uHEغeD(oAD8E8f8tMF MHHL}IH@3uHELeHD(QA͍CӹeCLaHQE8f8tIV LuL}ML}IE3E3IuEO0LeH]QA;u0HE` u HE H@0HHH@(S~tHEEHM@xHHEH>H d0YAD$0HHD$(AH <HD$ aQHMhHHH H@H4H HHHMhHHHPHAHH3[H$pH A_A^A]A\_^]HLH L@HPUSVWATAUAVAWHhHHI0HaHe@2HeMeHHeeHEHDHEH@}OH@|H{xu@HEHuEH .XHAD$0 <HD$(HcHD$ EAO;HHXXx HwDvAAEHEHAE3H^3HӅtHRuHMLHӉqHA^I]X3LDHtx~8tLF E3IEHIH@x~8tHV 3E3E3H+@DH *^SD$0HAHD$(<HHD$ EAK@}OHMHEHtHHM@HĘA_A^A]A\_^[]@USVWH$H(HH3HH@HHXHMHpHEH}LMLEHUFGH 芮H~HkH [3HHE8HH1H8HHLdHHM0HH dHE`HH0HHPHEh]]]]]HHH]@]HH]P]XHHHH(H]xH]pH]{HxH{H;u H3qH<(HHJH{HD EԶHMȾDκ{DFD$0HHZt$(HD$ H=vcH@HtPHH#H;u=HEfuHHDžHHD$(H(2H =t$ ILMHpP DHu(*GHHC~Hp!H~@x 9X f9X$f9X&HDNwHD$ LEHHprHMt 9r@LjEÈ]8]OY8=H0uyPe8HMLeAD$(HHD$ FE3LHp~uH %+OD$0W]Pe8HMLwEFHE8X8tL@ LHpHuHMLweFPAu-t(HE8X8tHP HE3HpE31tEHMU@}UUEE9XAH\$ LEHHpjpH] HLHML%WjHD$ >EHE8X8tL@ LHHپthLE3HpU}tHAH\$ LEHHpoi8]t2H /$rMD$0+H $YMD$0{LLHMJjEHEHf\$8E3HL$0HD$(D@zHP0\$ kuH #LD$0HE8X8tL@ LHpHͶPAu1t,HE8X8tHP HE3HpE3(}@}Hb HFzAHO HM0.z)HEHH(8X8tLH LˋLHULT$8LpLT$0DBzHR0D$(HL$ HPbAPe4HMLЉt$ LJyBHE}@}HP(8X8tHH HˋLLELT$HD$@EHzM@0D$8D$0HT$(3HL$ HPuH !+KD$0PAuqtlHpHPt(HE8X8tHP HE3HpE3肒u-HMHDL)eHD$ AHE@}HxHEHH(8X8tLH LˋLU0HULT$8LpLT$0DBzHR0D$(HL$ HcPe83t$ LM0HuLwH΋SAHE}@}HP(8X8tHH HˋLU0LELT$HD$@EHzM@0D$8D$0HT$(3HL$ Hu_H M IHM0AHL$HDNj<L$@H HL$8HD$0HD$(HvHD$ .A+PAuPtKHpH5t(HE8X8tHP HE3HpE3衐u HE0HHE@}HxH8DHEHuH hHD$0dH;}!HMLU}DΉD$ KjAHH+H0H]DH0HM`HEH$HELMHUHMH$HEH$HEH$HEH$HEH$HEHD$xPD$pH0HD$hHE`HD$`H8HD$XHHt$PHuH\$HHt$@HD$8HPHD$0HHD$(HpHD$ ]H]XuH=8]P}@}AuZtUHE8X8tHP HE3HpE3軎DLsHMe/>HHHuH oHL$ DȺeD@9F0u H HM>t8]oF0 odž NHuHH Hu:HtT@E3HHEA iHt33HNiHuHFxH0HH(u H3҈]HPa+DLEHUHP20HHP@H0HXLNjPf@}}@}n.DLHMHt$(HD$ }D$0 HMpPf'HuLDHHDT$(HD$ %5P;t HpHPu+HLDeHHD$ @}4HE8X8tHP HE3HpE3u#DLieH4]P;uYHE` uIHEH@0HHH@({au)L]MpH ULEE3Hat(HD$0ELEWHD$ HUH_Tu8]WuHMˎHL$0iL$I[(Is0IA^_]HHXHpHx HHUHhH3HM]_IH赍H;H]HEHMHIHE]H]]m_tKHEALE_HD$ HUHSu8]_t!!HU_HMH8]tH)GHGHM%hHM܍L$I[Is I{(I]HLH L@HPHHUSVWATAUAVAWHH3HH @|$P@|$QMH}HHMPHH :DHE HEHEH}(}0HMH}8}@H}}HMH}}H}ȉ}HMH}؉}H|$`@|$R4H1L5bZL;u IOHUL5HH 蔕HxLXo$'M A8}8tIE HHq L`L LPM@t$ IH@t$(AHD$ MIHX@t$(AHD$ MI]\H.@t$(AHD$ MI32L @t$ MIH@t$(AHD$ MIH@t$(AHD$ MIH@t$(AHD$ MIA8}8tIU HE3E3IvpHBHM)\XAD$@IU(A8}8tIM HDKzLELD$HLC0D$@D$8D$0HT$(3HL$ H -IH HHM[AD$@IU(A8}8tIM HDKzLELD$HLC0D$@D$8D$0HT$(3HL$ HMPlIHMPUXIFAA螼HEH8Hh|$xL@t$R|$TH[XLH\$pII+ILMMHD$`H3AH3HD$`AHhHHEHEYHHEH7L;u!HDHhHHE#H;HT$THT$ OMHMDHMHHhEȟ E9D$TH_HMHUHH;GHH+HH=1Au 9yu99D@D$TQADD$hUHpL&tt$xDD$hD$hAHT$`HMH+HHI;HX@8x8tHH HLhEHL$(MHL$\HL$ IIH@8Ote9T$\uZHX@8x8tHH HLhMHL$(DHT$`HL$\HL$ IIH@82Ot 9D$\t"HxLSe@t$P!HL$`IL31HD$`HEHEDD$hHHU[1HULE@|$8+L$`AI+@|$0IHT$ HJL$THH HMH` HMDHLEHUP@|$8@|$0HL$ H`؇DD$hLEHMD$TH;tAHH+HMHEIL+L;|L+LHEIMDT$xE HH@t$Q@8x,u HxLUEʺj!ֹKf8HxLUEX HxLQe; L|$pLXL`H@H@t$(AHD$ EMIH@t$(ENHD$ MIH@t$(EN HD$ MIHu@t$(EHD$ MIuHV@t$(ENHD$ MIUH6@t$(EN HD$ MI5H]HMU@8|$RH@DszHH0HH@ILDH@HH0XzHH@)LHIHIHH@HH0DpzHH@K@|$0LEHcLIκHHL$(IL|$ !A8}8IU @|$QH]Lt$`A+;tD‹D+I3$.LXA8}8tIM HLhDHL$(MHL$\IHL$ IIH@8>Ktg9T$\u\A8}8tIM HLhMHL$(DHL$\IHL$ IIH@8Jt9D$\u L@t$PL|$piLXA8}8tIU HH`E3E3mtLI߸I+H;~HT$`HD$THhDMHD$ 葙t9\$Tu;tD‹HL$`D+3,A8}8tIM HLhDHT$`MHL$(HL$THL$ IIH@8I9D$TLLM;9L`H IMXTIHMPD@A8}8tME LHhIHH@(nIH@HH0D`zHH@IIDH@HH0XzHH@)IHMHIHIH,ZHRH@HH0D`zHH@H@|$0LEHLIL`HIHD$(Lt$ SA8}8tIU HE3E3Ik.HPL H@|$ ML @|$ MH@HE3E3Ick@@8|$Pt%HHA0 qǁ @8|$QtH@@HD$`HtH5HEHt H$@HM>ZHM5ZHM,ZHMPsH gHA_A^A]A\_^[]H\$Ht$WH H?HHyH HH`FH=FHuH0H@tHlHt$8HH\$0H _LD$USVWATAVAWHH`H]H3HEAHEIAE3Et$LxH@I+uHYE9Hˉ}LMLEHUEHD9uu,fD9 sHEPHDfD2HUHˉ>E~HEPHHEfDuWCH=s(EHUD$(E3HEHD$ EALEHu89AEH;s$HHEE3HUHEA#Eʼn>AHMH3#H`A_A^A\_^[]A@;Bv3HHXHhHpHx ATAVAWH LI@AL`E3HHt&LgH=H3fDgLg HG(HG0G8IHu2WH_ DHI'H_HfoIG(FG8IH@DuHHHD맰H\$@Hl$HHt$PH|$XH A_A^A\HL$SH H3HHA\HHA 蓘HCCH [H\$Ht$WH Hمu!Q y v AD++{ C;sL9CvB;BHHt)DC IHSHo&HKHt5Hs{H\$0Ht$8H _LL$ SVWATAUAVAWH MLD$pLLLD$` 3IAT$AIu\$`HLLM;t\DA@;w_A;] rD CA#Du KHɋIH+J HD$pA+ԻӉT$x8LD$hIB t"D$hH;uuHA+ĉD$xE] AD\$`EKMuAKHA+A;/LD$`AI LL$xC!D$xDPt$`DILD$`O9|0u NHAA;G0ASD;u NHAA;sOD;sJAI IEHL$`L|IED$NHIEH|$pH|IET$x_u NHAA;D;s~t0FHMDM;tt NHAHD$ EAoAH A H\9@8p fLM LE8HUHMuAH  A|$0udIG0@|$sHHt"HLD$sHUH@H\4L$sHEH@HE@ֈL$sttHtDu3IHEHEDuH] DD$xH;HGظH]fD;t9EE;L$Dv.IL$8L;YffA;t$Dvt$x AD$DD$xDmH LMEAHgfffffffHL}@LIIH?LED$@3AD$DI @IL$HIEHIA89L4HE IcHA89uSHEDDϋLHHt"HLEADBDAH;rLMAHiHHAL}HIHIHJ I;~+A89u&LeLO7jfIL$8LMA1"L}LH}LIG0HHtHHUH@@2LEJ#ML;HILHI;s L+LEH}IG0HHtHHUE3H@822J#@uf9D$xI;Le\$xH;U~L}6Zf<@8 tLc6yf"HcEL9I+ֹHHH#HH HH#IL$8HºVfH H;HLLaI;LH;U~Zf@8 tyfHML5HI8$KHcEL[9I+ֹHHH#HH HH#HMHºVfH H;HI8HLLLUL+LcMM\$xHNjA9z@vrMBPA A HH HI;~fH\$xfA;w A;R@s4IJ8L8E˺[f\$x\ \$xf;tJIDMftHL~8IcILeHHMPHHMXHIL$8WfDL I\$xLeAT$@HM躃u{H  IL$8AD$0-DHD$(<H8HD$ IAH :fuLXfIL$8}Lu|߉\$xAD$0DL$(HT;{HD$ DIIL$8=DvhH@HDtUHDH#H;{DuBHEfMH H H HD$(HH ,DD$ fA$ Dp EAT$@I$@|$(E3DHU`|$ 蜞uRH  IL$8AD$0LDHD$(<H7HD$ AH A$pA$M$HDHt HL@ABDH;rMD$HIƓH(zdHwyH;uHt H4)HHVyHGyI MynHEILMIHD$XHEȊD$HHEDt$@LuHD$8MHEHD$0HEHD$(HEHD$ 2AH DA$ A$M$HHt HL>ABDH;rM$DADE$HAL$@IHMhMt!HH>ADDAI;rEºLIL[H&cH xH;uHt H'HHwHwI wqm?nA\$@HMD$t-nD$rH]p.HEXhHHHEH]HC Ht&HK(IMHK Ht ;H{ H OIL$8AD$0DHD$(<H4HD$ AH A @HMHtHHe+@8}t$IG0HHtHHUE3H@8;+@HH 茚H`cH TcH HcH`|@H H3H A_A^A]A\_^[]LE3[ D$rf;t$xqvD$tfvLs`}fu H$aHvH;uHt H%HHuHuI uwkLuI9~ Q IV`IN(< EFh3IN I H@t$rIFHIFE;l$@A݉\$|M$ M$ LIh@8|$ruu1HEDAT$0D+H`LExHD$ @|$rAT$0H`H](H9HU(H`٨Hp9x f9x$f9x&@pI$xHLHH D$tuLHE@8x8tHP HHEH`EL$0M@|$8@|$0HD$(ID$8HD$ " 'HpH@t!I$xHLHH@8}\$|DCI9F~IFI9F}IFH3"^HsH;uHt HL#HMHnsH_sI eshMljD$|A9|$@+HIL$`LƋHM$ M$ LIXfcL$|E;tzAT$0H`DEEHEHD$ L`AT$0H`CwE9D$|tLu0H9tHU0H`uLuAT$0H`mH`H`HH@&I$HLHH蘊DL$|L|.IL$8e)I$HLHHOuDL$|L7.IL$8eI9^~I^I9^}I^\$|A;\$@L$|;MvxHEILMLEHD$hHE@|$`D$Xp D$PHEHD$HHEHD$@HEHD$8HEHD$0H`HD$(L$ IL$|MA@}@}HI;\$HI;\$HI;\$ }߉|$ HEHH(@8x8tLH LϋH@EGzHT$8H`HT$0IW0D$(HL$ HϯRHEL`HD$`HID$8MHD$XAD$0D$PHEȊD$HHEHD$@HEHD$8HEHD$0HEHD$(Lt$ S@8}u @8}AL$0AugtbH`H軸uKHLDeIL$8HD$ AD$0 dADŽ$A$ A9t$0u.A$` u IG0HHH@(#E@8}E@8}EEEƉEމ\$ ALEH H`)0@8}E]t HE@0tDAL$0Au2t-HE@8x8tHP HE3H`E3&FEA9t$0u6A$` u(ut IG0HHH@("D$|IL$`ƉD$|A;D$@DufDfD;t$xfDuAH AH H 6IL$8AD$0DHD$(<H"+HD$ |AH mH oIL$8AD$0DHD$(<H*HD$ *AH AH H }IL$8AD$0\DHD$(<Hi*HD$ AH H +IL$8AD$0VDHD$(<H*HD$ qAH bAH MI9|$8t=H HIL$8AD$0DHD$(<H)HD$ AH AH H VIL$8AD$0DHD$(<HB)HD$ AH AH xI9|$8t=H sIL$8AD$0DHD$(<H(HD$ .AH H !IL$8AD$0DHD$(<H(HD$ AH H DIL$8AD$0hDHD$(<H0(HD$ AH {AH fH hIL$8AD$0DHD$(<H'HD$ #AH Lu@8p  A$ A8$pH H H HpHfH UHUH@pH HATHiH;uHt HZHH|iHmiI si_DA9|$@QHI$AHALHOHE@88uvL AItt`H9 tWHLHH H L0I~_HMEArH9 uLMH@AT$0LHC*H@כu@I$HLH HutIL$8L$EͺeyYID$PD|$ fw8HLELeI̋ëUID$H H@"ˋUMD9v0uE;E HEHuH]H@HE؋HMdHEHuH]H@HEHMdLMuLMd$HdMMu@uHxHF0LHN8e fD HEPEO0HD$ kHEe@8HE8V0iEO0L²HN8HEPHD$ DDe*H;FHVHxL]HE`L L+B +uHu(N0AuDÃuDA8]8tIU HI;A;~gt"H D$0|F0LHN8e gD HEPEO0HD$ HEe@8HE8V09EO0LHN8HEPHD$ RxH;FHVHxL48AG@IM(A8]8tMM LHULUPLT$8L|$0DBzHR0D$(HL$ HPHEHPHMLHD$@MHF8HD$8F0D$0HELl$(HD$ NUH;F HV HxLx~AG@IM(A8]8tMM LHULUPLT$8L|$0DBzHR0D$(HL$ HPgHEHPHMLHD$@MHF8HD$8F0D$0HELl$(HD$ c8]DDeH t 8AG@IM(A8]8tMM LHULUPLT$8L|$0DBzHR0D$(HL$ HP誌HEHPHD$`LHF8MHD$XF0D$PD$HD$@HELl$8HD$0HEHD$(HHD$ ;.De8]u EN0AuVtQIHP蝕u>HLEO0eHN8HD$ F0 hD 9~0u0` u$HEH@0HHH@(\U8]EEEUEljE` u >rLF8HPH=DeELEHU0AEIωD$ }^H D$0EI$IHH ϲZD$0H DD$0H .D$0H D$0H wD$0uH ^D$0\H ED$0CH ,D$0*H9^8H D$0H {D$0H ױbD$0I8]tH DD$0Eu EN0AA\$ LEIHIGH@tsH_LHuH /D$0 -HH HHotAI$H@(IHuI$IHDeEHE@8AG@ME(A8]8tIM HEO] s>HEMH HM@L1 HD$0iHD$( \$ ]DwD6A H:cLHu@H HM@EOD$0 EGHD$(<HHD$ _ HEDLHD$ IIG~ 9]u A?0AIL$0AFM L+F A+uHEut@8}u@8}tlU8e艱DMLHID$ HD$ 袿I$HMDmLH|$(EHL$ IH@8ILD9mBDmAOAW;HEHML$ L:D0HEHD$0T$(iL$ HaAGHMAGEI$LH|$(IHL$ IH@8D9mHE@8x8tL@ LI$IAWHH@(uH ȞSD$02 @8}vHE0D0jH $HM@AD$0 EHD$(<HHD$ HEHtHWHtHWDIW2H$hH A_A^A]A\_^]E3HLMMED8YtuLMt L9Y0tIAHID8YttHA8Ix+HHIx+HXA HLH HPHHUSVWHXHYzHHI03MHE(H2HE0HH}8}@A@8HH}@}}@8HH@5DDA;s M3AEH9HE(HAHEHEL2LEA;sHiHD$0LL$(t$  A;s4HLܝLiHD$(L$ HX製H H]H;wL;wDALX+HmHH] H;tFHLLiHD$0t$(L$ HXHHpSHESHESHESHUHHEH4HEH'HMHHLUfxfzfy3f~DHHH}AAZ AJDEJDHIHHEHX HLhLiHD$(JDHXHD$ HHPY BuCAA;t8Hpt3uHHE@8hu HAHE3RHEHHMDAIDHt H9DUHIHt:HiLHD$(IDLnHXHD$ %w HHu0iHLLHXHD$ ; LH]HH6\HLLiHXHD$(Ht$ 蚺LpAy0 HEHPHtHMALDL;BHHu@DŽHH}HEHMH.HE}CHEȊH@HHt5HPHMDHHHHuӄ| PHHt%H HxHH -HHxDHHED9xvCLMEYEHUHHMDHK9D tHEDD;PrEt AHMCH9HHHMHMHt5HQHCHMHH HMHuӄHHHH@tkH@ȉHOLHtEDDEt.HuEHUPH.CAA+D+HIE;rHuIP]HMA Ay0 Hx HHu iHcHUHHT$ HUDHL33Ʉu{H8u;H8H8tHH HpHHE3LHD$ =u5HLחLojHXHD$(Ht$ }U;uHEHDHLAHLUA:IAzN AzDAzXAJA(fA;sOLMHHD$8AQDD$0L$(JD iLLHXHD$ 躶 HUIBDBI;Dt?HHL$0HD$(IDLiLHXHD$ gUtHLqHL$0T$(i뺄t!LSHHL$0T$(i DBARA;tHHL$8DD$0T$(i EJLQAQL;v"HLHL$0iDL$(/AuIJLH,HH;HMXH]`HOHH,\HEHMPHTg?D3HMMD3HMHEDHPHH$D+HDH$HH$HH$HEH$HxH$HpH$H`Ƅ$H$HXH$P$H$HEH$HEH$HEH$HEHD$xHEHD$pHHD$hHHD$`HHD$XD$PHHD$HHHD$@HEHD$8HHD$0L$(HLHHD$  HMȋ>38u8Eu8pPeDLXHXHHD$ H`t6H@LHHH]hHZHMAHLHM[PAur;tiHHUHd$(LDHT$ HHUH@83u4HMJHMJHMJHMJHMJ 3AHME39Pu:Hp` u'HH@0HHH@(H03HH8HL0fA9zf9yHEf9xvTDH L@HIJAR H@(HD$(HD$ >d~HEH0HD@H8HEf9xvLDH L@Q HHH@(HD$(HD$ cyHEH8HD@詿H0)HMf9yvHEf9xvDAHI|IHEAD@ HH98f9yv?DH L@Q HHH@(HD$(HD$ 3c~HEH0D@HH8HEf9yv?DH L@Q HHH@(HD$(HD$ bHEyH8D@H螾HEAMH@9:D@ uLUMugL(MtfA9xt DH L@HEP HHHH@(HD$(HD$ 9b~H@EmHMHAR DI LAH@(IJHD$(HD$ ax H@EHELDH L@HEP HHIB(eHXHcHAE3iHH@ HMHHLHD$ DIML HYHUAHoOH3LpHPBu;tAtADEHMEu+f9y u%u HHE@8huHH@HEAHLEu H@HMbFLUMteH@9:HMLEAR AH|HLDIJH@(EH IHD$(HD$ K`H@x40HEH D@I|t HED@HH@LUAEB BEBH(K|I輻H}3H@LUAHpx0Et 9 xEB L0MuH8HefA9K0f9H&HMBEJ IKAS LH@(HD$(HD$ 0_~HEH0HD@H8LMLP HHHEI H@(HD$(HD$ ^3ɅHEHD@9:aABJ|PHEMBEJ P HHHH@(HD$(HD$ i^H@3H}LUDAHX tMHLLiHXHD$ zHLUL]H` 3DAMu+8hu EB EBIH 襹EB tECIH(H@9 HMBEJ IKAS H@(HD$(HD$ e]3ɅH@H}3EBIIHEH8HD@39MH@9vPu#HHE8huHH@HEH}HH=4UH&4HcUHHUp 4HEHUHHHH;D+LXy3ɄLU]MLULLU&QLˉHLHD$(HD jHXHD$ eHHMAHMAHMAHMAHM{A`LXMkH ~D$0AHD$(DH<IHD$ ;+HMAHMAHM AHMAHM@3H  HXAD$0DHD$(<HiHD$ çHM@HM@HM@HM+HM@HMmHUH;sAHEHLLH+HHD$0HT$(ujL$ HX3HUHZ t rHt3HB DfJ IffAfB fAfDBtTLUAHtMtKHED@HH(HU3H;U uB8hu:Z tHu/H$HEHuH@AZ t 9 xHMd?HM[?HMR?HMI?HEHxN+;HLLiHD$0|$(L$ HX謦H~H`H kHXAD$0DHD$(<HUHD$ 该HEHtH>HEHtH}>HEHtHl>HtNH_>DHyjHD$0t$(L$ LLHXޥH@@@@HM(/H_^[]H\$Ht$WH0HH3H$ IDA@HAv'2H$ H3$L$0I[IsI_AH ]BH;w3@EtDHL$ MHB萳HH=sAft HT$ HSH\$UVWATAUAVAWH$0HHH3HH0HL@ILHMHhLHD$xH8HEHPHEHpHELL$XLD$HLuL}wHMPE3H G0HEHHEAZLUDULUDUfDT$RuD9_0uEEEIEXL HHL+B+uHuu A}`0\$@tDT$@AI DLD$PHT$hI苕3LHxDH H HD$X@@HE H;8L$@Ht)IEXLăML$0jH|$(HD$ 3}HAE3jHH@ MMXHxMD$0HH|$ 膣ANf;rHHvf;rHcDIHpFHDHD$xH9xH;xHL$XLHxH](Hx2T$@Mf3ɈD$BDȄ"AV DrLEI3ɄH胨HAE3iHH@ HL$HHAF MMXH|$(LA0HΉD$ AN f;rHHDvf;rHcDDIHiFHÈ\$ALd$HHM؈38L$@;3`eEL$0LKHHEHD$(IEXHD$ %DL$BT$@L$AEuHD$xDL}H@ NAp@8`DHD$HH9x0u HD$X4LMHpL7 HAEHDDXI@8t$@t6HEH|$0HD$(L#wIEXiHD$ HD$HLH0o蹜IAE3iIH@ /HD$HHvMMXIH|$ L@0辖AL$f;rHHvf;rHcDII觖AFHDHHD$XEDT$@HD$HEtDL$AEuzHH0D@0H@H PID$f9Hu D9uf9PtPHfMHMH|$8HL$0IHD$(IEXDELvfU|jLMHD$ ADT$@DDL$A@8`E$L\$XIC9p f9p$f9p&IK0EC0PH fA;L$E;$fA;T$EEHE@8p8tHP HHEIL|$PDpM@t$8@t$0HD$(Lt$ ޢL\$XICHtIxH]8LH9X 0f9X$&f9X&HA@HELD$AH\$ HU HcHD$pH]AHD$ LH`HM g|$p\HL$HHAH;`kHAH;hZHEHP0DH0H@H D@f9Q$uD9I u fD9A&HEIDMfUfDE@8|$PJIEE3iIH@ èHEHHt$XIHD$ HD$HLF0LH I}HT$HAII[}ANHAԹe mDN0LfVIIEXHD$ '{HMHT$HA0EHA0H fEHAHfMHEHB AD$u:At4HE@8A9}pA8]tuIU0I跐@DŽ@|$@HL$xLD$hH:HEIΉ|$P@8IEE3iIH@ LHHt$XILF0!|HT$HAII3|IEE3jIH@ @HI{AH`I{ANHAԹekDN0LTIIEXHD$ yHE@8AD$AIKoH Y7D$0iHELHt$ IHt$X@|$A@8|$PLN0zAԹejDN0LXTIIEXHD$ yHE@8AD$PAFIn6H Y萁D$0HELHt$ iHt$XIΉ|$P@8LN0yAԹe]jDN0LSIIEXHD$ wxHE@8AD$AInH cXD$0oHt$XDLD$AHT$lIOkHD$HHtnHL$xH X觀D$0(H X莀D$0H WuD$0H W\D$0lD$@tKAD$u?At9HIJ9u*IEXLRHD$ eHEIDH0Mw@|$BHL$XHEQ@LQ(8X8tLH LLEHD$`H@ HD$8E@zHL$0T$(HQHHLT$ -/tSXHD$HHHH VzD$07EHD$(DH<IHD$ :w@@@HpH,HM(HM Hu@HH3UHA_A^A]A\_^[]HD$`ˈ\$@H9p|HHELHUHHMH0HLMHLASu H! A@H\$ LD$AHU H蛠HD$pH]AHD$ LH`HM |$pHL$H3DBXHT$HH 8BXfZ `BHD$xH fD$|HHfL$~HJ(HD$xHB 3DB0躄HE@8AD$AHELL$DHT$HHD@84I΄ 8\$D/|IEE3iIH@ HD$XHLIL@0=vAH`IPvANHAԹBffLuDI&tHu8^8tLF LHH]HM U8^8tHV HE3HE3&H S^|D$0yHt$ LűHt$XiLN0tAԹe9eDN0LNIIEXHD$ Ss@ψL$@DL4fI3sL$@HD$`H9p~cHEH 5S{D$0rHD$(EH1DǺ<HD$ IsHL$Hf 7Lz5frHt$HH R_{D$0E9\$PtD9tAD$AtGLd$XHI.4u+IEXLwMEL$0eIHD$ 4rL$@D L$@Dd$BLl$`A9}0u{A` untjHEH@0HHH@(uJMt8H QzD$0EHD$(DH<IHD$ IrH1 H$ EAE0 jEA H 8\$BHL$`A0 iD @USVWATAUAVAWH$8HHH3HH83H0MLHMHEHPHMHPHD$hLL$xLEHT$PH|$pH\$`nHMeHʂH]HEHH<HEȉ]H]]%H0\$B- H0ME3Iֈ\$(E3\$D\$ [ uH TPxD$0{HM~-LIxHuHH0aHI;|HL$P3҈\$@%^HL$PLD$ADHUbD@HEHpH0@LH H H/HH0tI9t$0uIwLMHPLAn:HP\$ARu jH`@xu j9X f9X$f9X&HPAHD$`LD$AH\$ HUHęHD$HALHD$ HUHM^|$HSHME\$AQ;tHt$0LPD$(T$ ifHD$`L@0DP0H@I DHfD9AuD9Qu fD9IT$0ifDD$\L0DT$XfDL$^HD$XHD$(HAHD$ ML$0I5oL@|$AHH0RHD$hAչe|$D@8_Ht$PLHEL$0IHFXHD$ mHD$p@8AEAH(cH MvD$0iHD$hLvI@|$A|$DHt$ @8ML$0hnAչe^Ht$PL7HEL$0IHFXHD$ lHD$p@8AEuAtHb@|$@HD$hLi|$DIHt$ @8ML$0mAչeQ^Ht$PLGEL$0IHFXHD$ elHD$p@8AEuAtHarH YLtD$0Ht$PDLD$AHUHF_HEHVD$@tOAEu@At:IH-u+HFXLFHD$ eHD$`IDH0k@|$BD$@Ht$xD;` HEH@0HHH@(utMH tKsD$0H [KsD$0iH BKsD$0WH )KsD$0)FHEAL$@IT$(8X8tLH LLEH0 HD$8Ld$0E@zL$(HHT$ IT$H"tQLHH J(sD$0HD$(AHDǺ<HD$ Ij@H0H2 HM٩HMHPh@HH3uHA_A^A]A\_^[]È\$@HMLH0Hj LMHPLAi;HP'AH\$ LD$AHUHP`HD$HALHD$ HUHM|$HLMLV3|$DID$iID$AD$I$AD$ fA\$ EAD$HD$XH fD$\H`Ht$ HfL$^IHD$XID$HD$h@8MI0iAչe]ZLCHD$PIH@XHD$ HEDH0nhAEu+At%HD$pHE3DI@80(@ψL$@L$@HI;KLt$x9\$DtAtAAEAtBHuHH)u+HD$PLBDN0eIH@XHD$ g@|$BI,8\$BPAdž@L+5fIngIH ~G pD$0AHD$(DHt<IHD$ gI8\$BAF0 kAdžA HHX D@HPHHUVWATAUAVAWH8HHEHMAdHHdHL$pHu D;usLHMDMLAe3?HM_.IV(A8~8tMN LϋM@H DEIOA,9q #f9q$f9q&H8r H IG0QH f;D$\A90f;T$^A0Ht$ LD$QIHGzAO@IW(A8u8tMM LHEFAFuOAtIHLHHL$`L|$HADt$@Ll$8HD$0Ld$(D$ tvHHAtAu7A8u8tIU HE3HL$`E39uLvyeIGHH;Xx!LLZoIG@HL$`H*A0@|$`LD$b|$ HUDHD0tL}hH]XA;T$hIfA9>f|$@HHH|$lHD$8MHD$a@|$0HD$(\$ tz@8|$a HfpHD$tH fD$xHHfL$zHD$tIA8}8tME LHHM蟲PDAuAtD$0!H u>D$0l!HLEH\$8E@t$0H\$(Lt$ ;EE3HE3AQ0mTE3HE3AQ0i^uAHr HM0qku9H N=D$0!{E3LE0HXmE3LE0H]uHfXH1HD$pH fD$tHHfL$vHMHD$pHfA@HH@HMtEH%wDDD$hHwlt$h}^HEHMHQABHIRH辝/HUH"[ AEuQAtKHEH fEHHHEfMLLMHpP@UBAEu5At/A8\$8tIT$ HE3LpHƒHEHL L LHWHH|$xHD$hH ,;D$0!\H ;D$0!FLdeI2LsdeI2H Y;D$0!HD$(AHhDƺ<HD$ I3D;t;uLdeIT2AEqAgH@HHpA8\$8tIT$ HLEHE3XHLD$`AHD$ H@H\t,HUH@HMHHAH@ 8\$`tH 0:D$0("AHD$(DHg<IHD$ 1LbeI71@H@蠖UH C9D$0L!HD$(AHuJ9{u&HCH uC)NH H HK{0u@8{)u C)fDFPHMId?HMHo>uG9{u&HCH uC*NH H HK{0u@8{*u C*flDFPHMI{dHMH0=uN9{ u#HC H uC+NH H HK &{0u @8{+uC+1fL_I-ALEHUI HH@HMbmHMYmL$@I[0Is8IA_A^A\_]H *6D$0"@H 6D$0"*H s 5D$0p"H ] 5D$0Y"HD$(AHVc<IHD$ EA-LH\$WH H(t HtH^HH\$0H _@SH HRHHHQlHH [D+@WH`HoH3HD$XLAH+HL$ T3HL$(DB0;HD$ HT$(E3HD$@HHD$8HD$0HD$(0H`t}H|tqPHt`Hx8tL@ E3HdTt9H(t-Ht!H/tHt2HL$XH3t6H`_HHXHpHx L@UHhH3H`=HEHHڟHMHEH]]H]]]wƏ;H8X8tL@ LHHM蟤t9ULEE3H%ct#DH\$ LEwHHUUu8]wuHMHMLjL$I[IsI{(I]@SHpHtvH$R3HL$@DB0:H$HD$XHD$PHD$HHD$@Hx8tH@ 3HD$(LL$@D$ 0HQt2Hp[LI[IkIsWHp3H;I[ILI\$XHICHHICI[\$hMDCH(txHHH@VtdH_HL$@_tOHH4HP(8X8tLH LLD$@LD$8D@0Ht$0L$(HHT$ H3tHL$@hL\$pI[IkIs I_HHXHhHpHx AVHHLH &HL$ EFH$AHl$ I 3L IuH8H@LL$ HL$stkAV@E3MH͍UB%tKHBu;t6HHt)H8X8tHP HE3E3HFxtHL$ H$y&L$I[IkIs I{(IA^HHXHpHx UHhHH@3HEWHœHHMHE]E]o s0H\$ DLEoHUH(Rt8]ouHU/HS`HNHMh=E3HMApR*hH"D3HuH6 HVFB FJ fFNF@H8A0EoHA0H fEsHAHfMuHHEoHHHMG0LV@EoHG0H fEsUBHGHfMuLMoH@PtYHAuGtBH8H@t-H8X8tHP HH8E3E3!vtHM"HMifL$I[Is I{(I]@SH@`HtBHx8tHH 3ɋ `LHL$(HˉD$ Lt2H@[@SH@pHt>Hx8tHH 3HL$(LHD$ pLt2H@[HHXL@HPUVWATAUAVAWHhHE3H6HD$0HH*HMHD$8LLd$@ADd$HLeDeHE'aHτugA\$AHAHD8`8tHP IL@E3HLt|ADewLEwLd$ HUNDuwtEtH1>E@EADewLEwLd$ HUHhNt EwL9euÄt(HH@@A0DewLEwLd$ HUHNL}HL$0DuwMDDEG@IWBEgE/Y[AH I H<A@1HL$@H6KE3L}oEtH+@A`DewLEwLd$ HUH\Mt EwL9euÄtH@ApDewLEwLd$ HUHMt EwL9euÄtH@ADewLEwLd$ HUHLt EwL9euÄtHt`@@t]HAuMtHHD8`8tHP E3D2)DIL@E3HquAA7HM†HL$0`H$0HA_A^A]A\_^]HT$HL$UVWATAUAVAWHl$H2HL$`D$AED$@L衅Ax8HEHHD$Xt Ix H|$HHd$HIt$0LEOHd$ HT$`APE_IKL}o(H}HH 襸LHHD$PE2DDuOE3HD$ IHL$`蝜uqj69|$PuE3IJtIK;r @|$@YUjLLz]I.!LD$HHL$`3D@}O艙t3HMWWOE3E3Xt@@}_D$AI0D$ALeW{H >(D$0SH %(D$05DuOEt,EtH v'D$0_HEw@8HE@88tkAAչeL;TLILD$HAIGuLLTeI@}_HEw@|$@@8HE8Hd$ LEOAHT$`IzI}HALuMuFH 'D$0HL$XLHuH _&D$0\A~4|$@Af4AչfL4SLIHEw@}_@8AEuVAtPHD$HHL$`HD$(AHHEWE3IHD$ t}WHtDMLVeHt$ IyAEuIAtC}t=LD$HHL$`Iu'DMLIVeHt$ I/}_AEuAtyHT$HE3E3IimubEL$0L5ReIDDuOEt;H %D$0HD$(AHRDǺ<HD$ I>@2HL$` @HA_A^A]A\_^]LL$ HL$SUVWATAUAVAWH8HL$PMLAF03M$A8o8tIG H$H$A8o8tIH$H$IMD:FLL$HALD$@IpH|$@Ht$HHH$LHO$HL$PML HL$PtoHD$`Xte$e H$LPL>L$HL$PCH$HL$PE3E3oktoHH;=IMD6ED;I腪IHtHHGI@HL$Pc@H8A_A^A]A\_^][H$LOLϺexH #H$AD$0DHD$(<H|PHD$ |H\$UVWATAUAVAWH$ HH~]H3HH@HL$PHD$@E3H4LL$(HPMHcHHXLD$8HT$HLHP3E~AHNEHHXH@H+IHu HH4oIH>LpH@I+uHJ4H0EHt D8HPEIHT$0fE EfE;LL$8AH H  AU0H H HL$PL05HL$P#HL$PH xHukDhLA9]4uXHD$(fP0, HL$@LMDNEu4Ll$(AM0AutHL$P|Ll$(HT$0fAfE;LD$ HHP薥toAIH;Ht$H3DAH`DHt9HXH@H+IHuHt!H<HHjtIH;|3EHL$P-HPѣAHH3c"H$ HA_A^A]A\_^]HHXHpHx HPUATAUAVAWHhH3DžH]Hj8HEWHTEHEH/HE{H(MHELfEH]H]H]H]H]f]@}]H]EHHMWIvp8^@} N@ IN0HH@CN@AVzHF(LANzHuxL}`Ht$@MljT$8HUHD$0L$(HMt|HLHUHLEHD$xIHHD$pHHD$hHHD$XHEpHt$PHD$HHEhHD$@HEL|$8Dd$0HD$(Ll$ Nt @@@HMFVHML$@I[0Is@I{HIA_A^A]A\]HT$USVWATAUAVAWH$XHHXH3HHLLIL`ILhHEH(HEH0HEH8HD$hHHHEHXHL$xHHELePLuHHH 73HE H8HMHEHHWHEH](]0f]4H]8]fEH]H]H]]]HDKHH;{{MI͉sADƉD$0HM|$(HD$ =?VveH@H3H AELD$@HT$XH HH2AE9uIEIH ;uH I]uH  D$0HH tmA8^8tIV HE3HE3OStHMLt$ DILɃtAtEAE0 rA iHxLA HD$ eIuAH  D$0AHD$(AH8Eĺ<HD$ IH .H5 HEDHD$ LD$@HH,Dg8HfLML5IHD$`HMf\$8E3HL$0H|$(D@zHP0\$ guH , D$0HHA8^8tIF HHD$(HHD$tH]AHD$ LH蛂|$tA8^8tMF LHHsI9HDA8^8tIV HE3HE3QA8^8tIV HLD$hHE3H\$ >HD$h\$@H9pxt HpxHH;}9IELDHD$8HEHT$09jHL$(IHD$ \aHEH]DHD$ HLHP|t }UIEL=DsjHD$(IHEHD$ HfDd$@hLML{3IHHA8^8tIF HHD$(HHD$tH]AHD$ LH軀|$tA8^8tMF LHHqiHt/A8^8tIV HE3HE3?O6HA;u2A` u%HD$`H@0HHH@(+XDd$xHFHM%5uH !D$0 HEDLD$@HD$ HUH7)uHfLML2IHD$`HME3f|$8HL$0HMD@zHP0D$(\$ dH b}D$0fHD$`HMp@zD$PHtHUH8HHD$`HH0HH@*L$PHHHMHH)AH A8^8tIV HH|$hHMLH\$ E3ƄuLMfL1I"=A/H9wx%@f}Pu8IEL ;DM:jHD$(IHEHD$ f}PADH}XLEHMHUHMH]膗LuL;AtKIEL:MHD$ ;jIIH HcIH H#LL LuH tHu HHAH;IELHD$0LH]tIjHD$(HL$ I&Lt$HHLHL$`LEL|$8HLl$0D$(Lt$ HD-DϺ fHD$ DGA9}0)I HH;v*IE8D;D;fD;u H9rfD;uB8B<ȃ@A;-E;tIHT$hE+DD$TILuA+HMЋEB;w9D$T&AA+AA DD$TA+AÃ>rHJ>HH;s8IH;rLJIEGjHD$(Ht$ IvIAE3HjIH@ $H|$hDO8IEHDt$XLHD$(IDt$ mAHE;IEB}AOHLJ(hIIAE3HjIH@ l$H|$hDO>OjIEL=4MHD$ I=A+Dʺ?jLMfL)IHMVHu IcuHAHJ' fHD$ EAE9M0u I IH9\$xAt|EsIA9tEHEHtLH跎BH AD$0HD$(<H6+IHD$ EaEDADHM4H@ZHM7ZHkAHH3HA_A^A]A\_^[]HHX D@HPHHUVWATAUAVAWHHHMMA3HL$`\$DD눝X׹!fL%IE3LM)IH0Dg4A8_8tHGHH@XDHH3HHD$X@AD$LDyD\$H3;D$Dt(DȉD$DL(IxtDD$L3AAuA8_8tHOHEt HMEL?HM;tHE@pf9X ]f9X$Sf9X&IAH\$ LD$@HT$`HMHH}HHUH9Z@ HZ@8_8tHG HHD$(HL$`HD$PAHLHD$ s|$PH8]t 8_8tLG LHUHL$`ety9 8_8tHW HE3HME3BuqLM LM'eI@HL$`gWHMH$(@HA_A^A]A\_^]DL$|L*eD|$ I@D$HDHL$XdED$HD;sTDD$L8\$@xH D$0HD$(AH'Dƺ<HD$ I8DAdLd&IEtHǀHZiH vD$0pHHXHh HPHHVWATAUAWH@D$3H$MMAGAHhH$HHH HcٹH#H H HH;HG@8~8tLF LI$E3HIH@0?uFH D$0H$AHD$(<H&HD$ EAn&Hu)H9=)ht L$EHHt$ IEhHX@8~8tLF LI$IH\$xHH@uH$L!eN@8~8tLF LIEHIH@RtEt!@8~8tHV HE3E3Hh?tAuP` uDHD$pH@0HHH@(u#H9$tH LgD$0@@Ƀtt DžM0L\$@I[@@s IkHIA_A]A\_^HHXHpHx UAVAWHHHLIHAL3HM0RHMRHbH HD$HHD$xGH\$P\$XHL$@H\$`\$hH]]HL$pH]]HXHL$@6$uEH 2D$0HAHD$(<H#HD$ EAHHL$@#uH D$0LFHM΋yH HD$@ALHD$ HU0Hu[8uHL$pb,HL$@X,HMRHM0RH:L$I[ Is(I{8IA_A^]HD$pALHD$ HUH4uH D$0HLMHD$8LE0Ht$0H|$(ILt$ &3HLL$@LfLRLLYM;uHBH9Au3JAPf;s DDL+A@ L;v 3f;3f;u f;uHL#L#M;rÃHHXL@HHUVWATAUAVAWHxHPM HE3MDHL}L}L}OHMHpA%H b_HH$HUHD$`AH_EHMAHUH#HMHMHD$hDL|$PL}D}L}D}L|$pL|$xEL}D}L}D}d E3LEHT$`HP+3HL$`4yHHXAWHH3ɅT$x3ۅt2LL$pMtt ;sMLA@b;G;rӍ uB迁LH?I 3D$THMA\$P3Ʉ D9L$xHT$PE3fAfE3HL$8L$0Ll$(A3ɄA8NA8NA8M HpAU0DI L <3ۄ`HpΔLHH7Ll$@HEHD$0LMHEHD$(LEHEHpHD$ BA8A8^HT$pHtD$xtD;s AHHHBIOBAG@DBHRMH]HtHHHAW@HHD$0HMHD$XH\$XHD$(E3HEMǍUBHD$ S88,H]3HHAH|$XHH HH0\$Pft$TfD$VD;d$xHAHD$PHHL$`.tHMHtHHDHMHtHH*HMHtHHHtHHHMtINHMm&HL$`rHMZ&HpNHM蕜HKH$AHPA_A^A]A\_^]H|$XDDHHXHpHHUWATAVAWHHI HM3M@MHJHM0eHZH HL$pHHL$@AHL$@HXH]]HD$xH]]H\$P\$XHD$HH\$`\$hMLXHT$@WHXE3LH\$8\$0E3I f_Lt$(J8_8_8XHM AV0EI L ttpHHH@t\HF{H@uKAHHL$pt2HD$pIDOHD$ L@Ht8@DNJHL$@:$HL$p0$HM0'HMIL$I[8Is@IA_A^A\_]HDH L@HPHHSUVWATAUAVH0L$3L$LH$L$pA,$I}D09$ A+uwH;$H$HD$$H+H;v $+H$H$DHD$ LI_9$L$pDËH$$+;GE3 H$Љ$$tdD$pH$H$DHI Hȋ$H$LT$xL$p;$H$A,$@I}D0@H0A^A]A\_^][H\$HT$UVWATAUAVAWHl$H3EH]wHELHWHMHEI]]H]H]H]H]H]߉]Lj]ˉnYMPLMIWp;E3HME33;"}-zHEH HMDHL$ DIH.^Le9}A<$TSCrCfA9D$A9|$DCI3.A;D$oAD$AG$AL$ MVDq]ADDIIIGXzAiyHEHGDe]HEHMEHL$ MIPHW]D9u]E5H}HDIxHHt'H0H^HH^8H^H^ H^(^@H^0HEHMF8u6ftLIt8uH8Xt蚜HL$HHHMHEHhA_A^A]A\_^[]H\$Ht$UWATAVAWHl$HPH;H3HE@E3HHHD$hHSHEHD|$0L|$xH LD$0AD}HD$pL}D}L|$HD8{tśHL$HO7ekDgHHt0HD$HH H HC({HCDcDs D{$L{0IHt3Hx HHH@IEHtHHH d =H@HHH#H;HD$4|$4HEHD$8HEHD$fDLEfDM HEIh HHD$ uEHufEHuHu(Hu0Hu]8@uHMZHMHT$xHrpF@y DA&HJ0HH@N@HT$xDBzDI LRzHF(HL$@HMDD$8M HD$0T$(HU[eHMsTI LHnHMYHMwI LHocI HiuI HbnIEHuMHf jIh HE3E3tf9APH`L LHIHt$(HD$ L "YD`tGu=Et8Lh H H `tHh HX L`tDIGHtfAA^EtA A^A^AHM(HL$pTHL$@ԤHM ;HMHA_A^A]A\_^[]LD$HL$USWHl$H3H&HEHH5HEH]]'H]/]7H]9taHEHHD$0LMHEgHD$(LEoHEHUHD$ ;t.EoȃwE{f9uEw9EuE}f9uHMHĐ_[]HHpHx L@PUATAUAVAWHH H7H Lp3WHMHMH HEM DM DHH"5HHH@LT$hfEHuHuHu HuHu HufuE(fHHHHHHfƅH (0H\H-7H >HMHHEHuufuHu#H#Ef0Dd$P@pt$TEfA'LAwI1LMHLt$(H HH H 3ɄA8OA8O HULHL$8LL$0Lt$(HR DE3Ʉt\E8OuVE8uQE8OH@HoE3Ʉt-H@VE3ɄtLH@E3Ʉ AADHH D|$XAfDd$^ft$\HD$XHLD$pH0HH H H I H H-HelHfehLD$xHD$xWH2HEHHE0H4HE8Ih DMLMPLM`LMxLLMXM |$`ft$dfDd$fHT$`HD$ EDfE@t6HT$hHzpG@yALA&HJ0HH@O@LT$hEBzDHG(H|$pA I HL$@HM0LcARzDD$8M HD$0I T$(L HUQ)HM0iI A HH H |HHH;JHJ0A?{HM0OHL$xDd$P3D$TL`ID$TL`;XAEMh I I `ZtIh IX LFZug@pfA[HEHf!H3HEDAHH I )dHMph3tDd$P;HM0NHL$x@EtAHW HK HMRH@趍HzHnHBNHM9NL$ @Is0I{HIA_A^A]A\]H\$Hl$HL$VWAWHHL$@IH3HT$@A$L$\$ HϋD{+8$urAL$At$ HT$@H{uDGHH9D$XH9t$`}H@8\$Qu@@u@<ELHLt$@L$8Ht$0HD$(HA@uULDHLt$@D$8HHt$0HD$(HHHD$ @HH;|HHH;H;HHH;A~0A<HfL$dfL$fD$`HL$`H XfOIh LL$XLHXHMLHHI LD$XLHHM:Mh HHM'HD$pHH0pzHH@DDALHD$hHHnHH~~IcLHMLELHD$XHD$ 0tbD9d$Xu[LHMHT$hLIcELHD$XH\$(HD$ 5t&D9d$XuHT$hHIcH;|HMH\$hY@@HLI Ë\$(HD$ :AuMH^Ih HE3E3 tA~0u=Et8Mh I I _Rt9Ih IX LERt@@HD$hHtHL@t@8\$RtfAEAEEt@AE@HMHM{H诱H裱@HhA_A^A]A\_^[]HHXHpHx HPUATAUAVAWHHHE2HD|$@MELHMI 譄HL$`3E3fE3N@HH H ؈HHD$8L$0Lt$(gD8~t@Y~5>,M HAV0LDH]ELd$ LD$@HT$`HD|$@EH}HMHcHLL$PLD$H^9EHH9T$H3LL9D$P!Ih Su A~0@tefA~0LHIh ]YIh AIX LOt A@tfFEtHL$`HM艃H=L$@I[0Is@I{HIA_A^A]A\]HHX L@HPHHUVWATAUAVAWHH`HEhE3HM`E2D!uhHAH LuDm@<HK0[zHH@DDAD}ߋ HHEHHMhMcHL$ MLEPDHH,t 9]huAH]PH4;gLmILuHHHEhELHD$ II+tD9}hu HIH;|LuDm@H;!HEHHHpH,LMHLE!7H}H(-GLHtIf H-II^I~E3MH}HH+H;HOH}H;}TDmMLH~8HUHEhHMHEMHD$ *tD9mhtIF HMHH;|Dm@D}H}I~ tHM`IHH@kt)IIHQE3LuH;AMtIHI%HMGAH$H`A_A^A]A\_^]H\$Ht$WHHHHL$ 3вH9^xuXL HL$ W0{t@HL$ Yt2HHL$ 0t!Hh HL$ E3ۺEHL$ L$I[IsI_H\$UVWATAUAVAWH$HPHjH3H@HM LE3ALL$PD$@HD$BADD$DHUM H~HMPL!8HHD$`HL$`H!EHD$hHHH!HD|$CHt$XL|$pL|$xE8t_H83ɄtM]E3ɋE3H HH fAMHD$CAMHD$8L$0Lt$(3t A8}A@@|$@HL$`8MtIIHt|$CtfAEAE@tAEH7HL$`7HMHN~HM AH@H3GH$HPA_A^A]A\_^]A8}|A8}rM HM AV0LiaHM WPHD$PLD$BDL$DHUHM HD$  D$BD$@ H9} HH<H;}WHMHLL$XHLD$Pv2tjHT$PHt_LD$XL;|UIh LuEIH;|HHD$`Lt$(DHD$ LHU3ۄ@9\$xuA2AA'A~0@uA3HL$`9LHMh HMG HMIW\$0D$(HD$ R:u4Mh HMG HMIW\$0\$(HD$ ":MG HIW*6IIH^NIHRtyA~0(Mh HU HMtVIh HM E3E3It H3HfHEWLEAHD$ HIHDutEtHHH[3[H;Cu@QHNH;Cu>H u QH HNHjH u.H tH HNuTHP6H;C uH@ uu5HPH \uHPHD$`@A>HD$h H$H\$@@Hl$PHt$XH A_A^_HHXL@HPUVWATAUAVAWHHHLH3M@\$q\$pDIG8M HEAG0EI HEH]H\$xH]$PHMH]H]]]E\$r@HMH H HI0HH@HD$rfA$HD$8E3A\$E3H\$0L|$(|A8\$t ƅA8\$A8$M HMЋUL覙^HM=FML|$@HHD$0LMHEMHD$(HUHD$xHD$ Mu Ll$xuA8\$uHMHD$pL|$HLMHD$@MHEHHD$8HEHD$0HEHD$(HEHD$ RbA8$XLuMDEnXA1HEH!HMEHL$ LIH D9mLMAI AAEMu DA DEIIK)HUL4s-LL;zHMMH|$(iD$ I;wI;iDMA+LEIipHMHEHH+QH;t2H|$0Dl$(T$ iLL[HMM藙.M~0HELHLl$xM|IEX3ҋMuHLHD$xAF Av3ҋMJt6HHLHHHHHcUHM;HMDHL$ LIIE9EHUHL$pL|$HDHt$@HHt$0H|$(HL$ HM8\$pDMHD$pHUL|$hHt$XuH|$PHD$HHD$qHD$@t$ tD8\$puHAF uRAFLHEI;r0LEA+DI.huLL$xLU@t$qo@t$qL@t$qƅMH9]t}D$puHLEI AD$(HD$ k Ih HME3E3H|$0yjDl$(D$ Ll$xLLl$x}D$pRE3HMMƺNE3HMMƺ:E3HMMƺ&HEE3E3f!HHMIh tEMh I I h4tIh IX LN4@HMHtHHqMtIEIHWHMHtHH=HEHtH.HEHtH.@t8\$rtfA$AD$8\$ptA$HM{HJH$HĀA_A^A]A\_^]H\$Hl$Ht$WATAUAVAWH0:3AHIH;L$D$+HMG8eL$AH;swL$D$G ucI LGDO IMAU HD$(Dd$ Gt/x5oHH;s'D$MG8+Heu HAH$H8H$Hl$hHt$pH\$`H0A_A^A]A\_H\$UVWATAUAVAWH$H`HH3HPH3HEHHDHEDDMDLEDH HMH0H MHHEHU\$r\$p\$qH]H]H\$x.HM GHH]H]]]EH]H]\$tEHMfEEfEHI0}HEH HEH\$u\$sH]H@tHEE3E3HfXHD$uHD$8HE\$0HD$(eHE8Xt D$tR8X~8vEHHuUH DL H HEL0H=LeHE Ht$@LMHD$0HHD$xMHD$(HEHD$ LmALeHt$xDt$pHMtIEIHZMtI$IH@HtHHH'HEHtHz*HtHm*HEHtH\*HEEt8\$utf@EtHXHM FH#-D$tHPH3脛H$H`A_A^A]A\_^]HE8X8HMHD$qHt$HLMHD$@MHEHHD$8HEHD$0HEHD$(HEHD$ LeHt$xuDt$qALmD$qD$pMu HE<}@Eu EMtID$X3ҋHHEHHt^\$(HE3ɉ\$ AH,t1DHEHLHHD$ t 9Et LmALmIEhHEHuAAEXEEff#fEHE)'HEHLE3H螞HMD}HHUEzHMELEDMfAHEHD$PIPHD$rfDy HD$HHD$sHD$@HEHD$8EHL$0D$(D$ D|$rEL$sEH HEHE@ LUMuL&HELHHEL$spHtHxM3HHHMwH;EmHLcHDHHMIHL$ IL ?9}6HMHD$qL}H}DM@I L|$HHt$@HuHL$0HHMH|$(HD$ zD$qD$pHEHL|$hHD$XHD$qH|$P}@DHD$HHD$rHD$@ED$ D$qD$pL|$PHD$rHD$HHVHD$sDHD$@LHEHD$8HEHD$0ED$(D$ D|$rEL$s?Ht$xu)D$tDt$pDt$qDt$pHt$xAH}HEM@xH|b$HELHu3HHHUHEHMH;EHHMHHL$ HHcU@ILDLI!E@9ELEDHML uHULD$HH|$@HL$0HL$qLt$(HL$ HMtQHEHUHD$hHEHD$XHD$qLt$PDu@EHD$HHD$rHD$@ED$ D|$rt D$qDu@D$pDu@D$pk}aHMAHLMH9\$xt~HEH9EstH9]unHHHAHH3HEHH|$xHLh (t&HHLEHH@Mh uAH}Ht\AHHGEI $HHMcHLHA8HMH\$(HL$ I=tD9ut9AHt$xDt$pHMHIELh IH@tHEHE3E3Hh Ht$xDt$pWD$tMD$tHt$x#Ht$xD|$rA$Ht$xHDt$pH}UHHXHhHHVWATAVAWH H$E3DMH@(HAL A0uBIH0L L+F A+u HEuGHSHH DH A;Cu8f;u3fE;u-IH0LP L+F A+kHEu]HSH DA;Cf;fE;IH0L HL+DF E+u HEuEuGL L+F A+u HEuG uifudIH0L HL+DF E+u HEuEtL L+F A+u HEutdGXHS H DA;C uRf;uMfE;uGIH0L@ L+F A+u HEu.t G@EtD'@HSHH DH A;Cuf;u fE;HSH DA;Cu f;ufE;taHS H DA;C u f;ufE;tB uft8H LD$PHtXD$PH HCHtiwt Fu;v@OIN0A^zHH@ADDD;v 3AO ;t@@w GtMu H$@tHL$xH\$XHl$`H A_A^A\_^H\$Ht$UWATAVAWHH`LePH3HEH+MHEHADH]؉]H]]ADrLEȋIu[3HsALEHUH`xHt98]u6H ;uLHPI賔uHEXAx0u HztHME4$L\$`I[0Is@IA_A^A\_]HHXLH L@HPUVWATAUAVAWH(HLHM3D@t$q@t$pDIE8DI I HEAE0E@t$sH}H]HuHuHuY9HHuHuu@t$ruE@pHK0[z@t$u@t$tHuH H HH@E3E3HD$u3HD$8f_H\$0MLl$(蘳 8_t ƅ 8_8M HULłf HY/R HHELl$@LMHD$0HHELHD$(HEHD$ cuL}ALe3vD8guHMHD$pLl$HLL$rHD$@LHD$xHHD$8HEHD$0HEHD$(HEHD$ _Le3ۄu L}A8uMuH9]uDE }|$xDEEu DA DEMtID$X3HHHEHHL}HIOh3H9uzM̉EMHfEfEHD$qLl$8HD$0HD$pHD$(HEHD$ pDt$q<Eu8\$pu ƅ%AGXLaHM3AHHH;HHDEHtOH3HHHHcD$xHIL$pHIHLMHLE HHHHHv H9ED$xȉEHEHLuHMHHL$ HIH|$xILcDL9}HMHD$pLl$HDH\$@IHH\$0Ht$(HD$ |$pLl$hHD$pH\$XDHt$PIHD$HHD$qHD$@ED$ 3ۄk8\$paMfI>Dt$qA $HEI< A+܉]H;DMLE+HQL$xHELH%LuAAA9];QG AD$ 2u D$pAD$ _H\;HM3HD$rHHMH;EHHHHcT$xHMLHL$ DILIOD$x9Eu{HUHL$rLl$HDH\$@HH\$0Ht$(HL$ HMtBDL$xHD$rHULl$hH\$XHt$PHD$HHD$qHD$@ED$ tL$sL$sD$r38\$pDKt $D$pAD$ 3DO _HEHH;DMLE+H7ODMD;uc8D$pu]HM H@L+B +uHuu0DG HD$pLOLl$(HUHD$ ti|$puYDMGHLUDDMADED$pAuDt$qƅuGHL83%Dt$qLe3AOE;tADED$pAu ƅG tHD9H33HO f_ HfA ffO ffWtHD9DEGHUA+AL$A+;uA9T$uHucA;L$t\D$pAAD$AT$Hu9AD$IMh IHH@(?Dt$qLeD$t D$tLeDt$q|$x}=8\$p3t>HHM=HIh HE3E3 "Hu IHMh IH@H]HHCDϋMHHI $HLcLHA8Ih HL$(HMHL$ IJ3ۄtA9}uA~0D$P.fDL$@HM@ILL$XHD$8HD$QDL$0LHD$(Dl$ +E3ɄtD8L$QtALD9fD9fD9HHL$RLD$PA~0zEDL$`ADL$X"HEPHTH\$XHt HTH\$`D;HL$xEߴKED,EBA@ LHHxIT$HM@I$E3ɄEIL$BAD$@EL$ADEHUMrHHpHD$0E3HD$hMHD$(AHD$pHD$ 10HL$pf9Au9u f9AtAGDt$`|$XApD;U;MIHM@=;AIHLA~0D$Pp럊pHpLHL$0AHL$hHL$(HL$pHL$ HG/t=HL$pf9A9f9ApWHWHM@t p7pqHtLLAHX/tFHE"L@Et"Ih HM@E3E3BE3ɄuAMtIQ HL$hHtHHҜHt HD$PtHL$x1HMHM@n@H(A_A^A]A\_^[]H\$LL$ UVWATAUAVAWH$HHH3HHxHMLMHHD$pHHD$xLD$hLl3HM\$AD\$@DH\$`H\$HMDlHMhL V0I L mHMA\$ LD$ADHUHM\HEHH=?"HD$PALHD$ HHMo|$PHhLH|$hE3HHHD$@HD$0HD$HHD$(AQ HD$`HD$ e,t%HL$HHtHHšHH\$H6~0AtdLH\$TL H,H|$Ht:HD$pD0ALD$AADl$ HUHMΠ@t$@A@@t$@AH|$HAAHtHHH@tAHD$xA$EtA$HM?HMvkAHH3wH$PHA_A^A]A\_^]HLH L@HPHHUSVWATAUAVAWHHHMIiE3HL$PDALd$HA܈ELd$@H:LPHMD,(I M L AV0]kHMAL$XHHEL$@D0LDd$ HT$PHM,L8LLeMQHH E3HD$0MHD$@HD$(HD$HHD$ )t\HT$HDB BA;AHHB H;(HL$@E3HtHAT$H Ld$@jA~0A3HDBX}zH 3fF E3H 8EFXHH(HF A$Fg*t6E}0LHT$PA@0HMD$ ڝA~0uAAAE@HL$@HtHH3HH@t HHEtHL$PMHMh@HA_A^A]A\_^[]H\$Ht$H|$UHHPAH{3HEH1HMHHEHH]I]H]]HFLEL+B+uHuu0~HcDHM躟tlHFHUH+DA+u HEuu=HDHMyt+HFLEL+B+uHuu@HMQHt$hH\$`H|$pHP]HHXHpHx HPUHH3HzHEH֞HHMHEIIH]]H]]ʞHFLEL+B+uHuuBHEXLLM0HUHD$@HEPHD$8HEHHD$0HE@HD$(HE8HD$ HBHMMHtZHFHUH+DA+u HEuu5HEXLLM0HD$@HEPHD$8HEHHD$0HE@HD$(HkBHM֝HtHFLEL+B+uHuu\LMXLEI IAHH 9Eu;fD;u5f;u0HEPLLL$@LM0HD$8HEHHD$0HE@HD$(HEPHMJL$I[Is I{(I]HHXL@HPUVWATAUAVAWHhH`HHM3D\$Q\$PDH DH DHEH\$xH]H\$`H\$hH\$RQcL!|$8E3fE3_fD$t\$V\$XHDd$0HfD$TfD$vE\$pHt$(腕3҄o8Wt D$R`8W8HD$pfUH HD$pfEDLM]HEHH H0 HLc‹V0I M L td3҄H3҄B ;uf9T$puf9D$Tu \$TXLHEHt$@LMHD$0HD$hT$THD$(HHD$`MHD$ 3҄LI3҄T$pHD$PLeLL$VHt$HMHD$@IHEH H UHD$8HD$pHD$0HEHD$(HD$XHD$ 3҄oH HMEL$zL|$HL@D$@ED$8D$XD$0H HD$(Hh HD$ 3҄ WHƅfHL|$hLl$`Le8WuHMfZ3҄T$X9-LIE3f'HHT$8E3D$xT$0H H0fL$|fD$~H\$xWHHt$(3҄8W8W`8XLM8T$TLD$hLEfD$lfD$nD$`fD$dfD$fHD$QHT$`Ht$HHD$@HD$PHD$8HHD$0HD$hHD$(H\$ 3҄VD$XID$X;Dt$Q~0u8t5HHM#3҄tyHh HE3E363҄tZ8T$Pt)D HM AV0I L ]YH< ELt$@HEHD$0LMHEMHD$(HHEHD$ M~MDD$h fD$lfD$nH0HT$hLt$HHD$@HD$XHD$8HD$xHD$0HD$`HD$(H HD$ E3#LD$xHD$PT$`HMHD$0E3HEHD$(HD$pHD$ u@|$P@AH|$pD80t!HHȉD$XH HH0fT$^fL$\T$^L$\D$Xu fuftDHT$XE3Ll$8E3Dl$0Lt$(誌D8nD8.D8nHHM AV0H DI L [H^DMW A uDEHOD$0LD$QT$(HUpHL$ HWDd$Qt D@|$PEt D8nuA~0DtLD$xHMT$`E3DntHHMrtIh HE3E3tA~0DuMh I I =tIh IX L#H@HMHtHHIHMHtHH2HMHtHHHMHtHH@tfEtHMp6HjYH^YHMH$AHA_A^A]A\_^]H\$WH HHHHIHt HcHmpH@tHHH\$0H _HHXHhHpLH WATAUAVAWHHL$0IL詾E3IED$AAQEDl$ @$@H$HE@D,EBHHtHcHH3HIMHCHMHHhM@E3HCHfDlHBHHH@@tRAADt$ A0L$HT$0I肌*HHH@ u@ @$AH$@8HtLHIƅHL$0L$AI[0Ik8Is@IA_A^A]A\_HHXHpHxLH UATAUAVAWHhHHMML3HY{HD$ IH2DHD$(DHt$0ufuHux3IWHHL$ Lh<HD$080xpHF@EBEwHHtHcH}H3HMwHHCHtpDEwHHgN@HHC3ftHBIIH@Qt;HE3E3IHHIIH@ uAAHED(HtLHIHL$ D:HM+L$AI[0Is8I{@IA_A^A]A\]HHXLH HHUVWAVAWHP3IȈXIILH@ zD{HHH@H\HLHI9$umHH f9$u\H0f9$uNAA@f\$@H\$8D|$0 EBH$HH$HD$(L$ It58$t,fAHHAH@ ;IIFAfxH$HPA_A^_^]HHXL@HPUVWATAUAVAWHHH HME3ADd$P\$QAL LeLeLe3 HEhRH\RHMp裹HH YiHL$XHL$XHD$`Ld$hLd$pD$x3fE&E3EfE3HLd$8Dd$0Ht$(肄E8ftAE8fE8&HE3Ld$8E3Dd$0Ht$(8ZE8fuE8fHE8&?HA Df |$Tf\$RÃu fL HV0DI L !SHHL$XHD$QLD$XHD$ HPE3ɄA;u f; KDD$pEAEL\$hMtEt A;sIIHLJAAA$<t IH AAA;rA+3E@HL$XHMHtHHHMHtHHHMHtHHtfA@tAHL$XHMp̷HQHPHM;H$AHA_A^A]A\_^]A\$Q@|$P2D$THDD$RL V0I L QQE3tHtHt$@HEHD$0L HEHD$(LMHEHHD$ uAE8fuL$pA܅LD$hMtt ;sIIHLRIHLH I09f9fD9~0@@|$P0AB@HME3MEBLD$X Hf$f&L L$pLD$h;~0@|$P@HHM(xHh HE3E3蛠WHh HE3E3z6Lh H H Hh HX LA\$Q@|$P@|$P\$QAHHXHp L@HPUATAUAVAWHHH`HM3D\$PDH\$`H L HEH\$hH\$pYH@MHM``\$XDD$TsLfAE3A_E3HHH\$8\$0Ht$(~oA8_tAaA8_A8LHM`HL V0H H LM HM`LPHEHt$@LL$`HD$0HU`HD$pHD$(HD$hHD$ 蠨thAuaLPHD$PHML`Ht$HMHD$@HHD$xHD$8HD$|HD$0HD$THD$(HD$XHD$ 衰Dd$PAHL$`HtHHzHL$hHtHHzHL$pHtHHzEtfAEtAHM`LH@WHMNL$AI[0IsHIA_A^A]A\]D`HM`Lh IHt$ S!~0AuAHh HM`E3E33u AE~0uLh H H Hh HX LbDd$PAH\$LL$ UVWATAUAVAWH$HHH3HLpHM3LEHHU@|$qDM DI L}HE@|$pH}H|$xH}HH@|$s}E@|$rIH|$8E3@|$0E3HLl$(H}H}fA?Az{BA8t D$r2A8A8?}HM AU0H H LJH'HuHELl$@LMHD$0HHELHD$(HD$xHD$ 3u Lt$x&E8wuHMHD$pLl$HLL$sHD$@LHEHHD$8HEHD$0HEHD$(HEHD$ 8uDd$pLceAAHELt$xHHHXHMD}HIHL$ EIHLeLIogD9e]HXEHMHLl$HHD$@HD$pHL$0HMH|$(HD$ Dd$pEHEHDMLl$hHD$XHD$pH|$PHD$HHD$qHD$@ED$ Dd$pEHMHHHM^$u@|$q@D$rL}FLvL39`v@I;6DMME8A+IGAFHMLuL;`rI;DMA+ME8IA}0u]H}tVHMHVcHHpH(HxHEHtHpHpD$sHD`LXHULl$0D$(Ih HD$ x;o;w/A}0DZIh HE3E3RLt$xL}=AvJt6HPEuE HHHHpLHLHHpfLIMLt$xHMDMHHHL$ IHUIHEL7E9E+HMDLl$HHt$@HuHL$0HHL$pH|$(HL$ HM*Dd$pEHEHDMLl$hHD$XHD$pH|$PHD$HHD$qHD$@ED$ >Dd$pEFLvLHEHHI;r]A^ HMMFI EN Q HH@(HD$(ED$ Hp\$rD@|$qHp@vLt$xHp@]A}0u@Mh I I Ih IX L\$r|L}Dd$p@HMHtHHrMtIIHrHMHtHH|rHEHtH@tfAEtAHCHHMD$rHH3PH$@HA_A^A]A\_^]HHXDH L@HPUVWATAUAVAWHHHLHM3E@|$pDH}I I HuHEH\$xH}H@|$q}DE@AHMH}HI0HH@TqH}f>@~EAHE3H|$8E3@|$0Ll$(s@8~t Dw A@8~@8>HM AU0H H L CHHHELl$@LMHD$0HHELHD$(HD$xHD$ 覝3ɄH\$xAHMHtHAH@pHtHAHH)pHMHtHAHp@tfEtD>HAHMH$AHĀA_A^A]A\_^]8NcHMHD$pLl$HLL$qHD$@LHEHHD$8HEHD$0HEHD$(HEHD$ E3u Dd$p L9d$xAHADd$pADL1@|$qULHMDI9A;uH;uIBH4MuM HELHMHHHHcUHMLHL$ HL$xDLIE9EHDLl$HH|$@H}HL$0HHL$pH\$(HL$ HMyDd$p3ɄEHHDMLl$hHD$XHD$pH\$PHD$HHD$qHD$@ED$ 舟Dd$p3ELUEz$tHAJMBL]LA@ APHH;N I;qt2LEA@ MuMMu@|$q@AH\$xHuDULMA׋IULM;s&HE@|$qH\$xHuDA}0Eu @|$qELl$0HUЉL$ MHuH\$xHuDIh HE3E31uEA}0uMh I I tIh IX Lit[H\$xDHuA~Ht$(akA8~t DgrA~A>L HV0L:+HHt$@H0HD$0L HD$pHD$(LL$`HD$hHHD$ "=A~2Ht$@HE`HD$0L HEHD$(LL$xHEHHD$ הA~HEDOHD$ LD$PHUH2eD|$PEHMHD$PHD$HLMHt$8HHD$0HHE`MHD$(H0HD$ D|$PtY~0uPEtKHHtALh H H t#Hh HX Lft D\$Q@HL$`HtHHfHL$hHtHHnfHL$pHtHHVfHL$xHtHH>fHMHtHH'fHMHtHHftA~EtA>H0HMwxHM.Hb7HHM`H0AH0H3CH$H@A_A^A]A\_^]H\$LL$ LD$UVWATAUAVAWH0HjE2IXXHE23@2LH;v@ DbH+D+D;H;H;HGHHH$H$DHD$ LH tt$H;uhDHH5GuNED4APHH=w-AE3ۄHME3ۄHEXD9X fD9X$fD9X&fEt fD9hE3LHtHOIM_E_MM%IIwHL$p菷E3ۄHMEHHD$BLEHD$ HUE3ۄDD8\$B93HMAAJE3LHMnA]AuQHt'@uIIHVHHHUAuAI@@"3HME3LHuHtHHHUE3IHtL MI~HMIH?Hlj|$HH LI0fD$LfDl$NqE3ۄD$PGD@MD0A&@@DAAE AAEufEtCHM$D‰fH* HH DɋIB(Ht@H M $fHH DIA(I L IYTAM$DfH HH DɋIB(I L IT}ttH IA].t H IEu HI$3H@SE3ۄ&EAӅtFLUMMt t ;sM0MIFAH@DA2w I;rҋDEu;tHI=ctLWHMELH IL@I$IBH@0St}IIHRE3uHDM$ffH~ HH DɋIB0I L IRt\$CMtIIH{RMtIIHeRHL$p+HL$pmHMdHM[HM貸HMPeH#D$CH$H`A_A^A]A\_^]H\$ UVWATAUAVAWH$HpH&hH3H`H 3Lj8HL DMXzHMAMAL$pHH0L0HT$xL}H@|$qE@H}H@mQH}L*ȉ}HS6H]DHEHHHHޭHE MH HMHPH HH}}HX`HhpH(0H8@H %H HH~0H0HLȉHH=cIEH3EȭHULEHt$ HxIE3t } s?A@|$pL0A}AE3E8((Ed&AGEP&Ee g&F0 vEHEH cE^ 2H/H;uHt HJHH=H3 },HELUAz Mr$$9Es ADt$qLS!{I!HLH$H؅t1LL+KHȉEH0H fMfEHEIM@IuHELHMAEAHt$ DHOa@|$pDA}AHtH L}H]VLEHH;uHt HIHgH=H }(HELH@ HȉEH0HLH IfML fUHUI L LELEuu AGLMغ {LTI HELHUHAEAD@B@|$pDA}An8H5H;uHt HHHH H=  3HEA HH;uHt HHHǃHĘH;uHt HHH:H=H HH 1H(H0LEL8D@LHDPNHKH;uHt HHHH=*H $DMA0sH(A^&LUAJ-ErI I HT$xLhLHt$0H]HD|$(AEADt$ DD$pAEA oHH;uHt H3HH=H؃ H=LD$xHHHLDLDnHH;uHt HH3HH=jH[ d}0s H?LUEzMJ AA D4EIHȉD$xH0HLH IMfL$~L fT$|I L HLEAAEA EBE.9EaIQG@u HKILEI~LHT$xEv{u HiDEH0LHHpLEHFHRLHH1{HD$(LHEIL0HD$ ^ DELHT$xHt$@D|$8Lt$0H|$(H\$ H]HAEA`VDHD$pAEAHH}H HHHHLDLDLDLDRlHOH;uHt H 1H=5HF3H &}0H}sAHHHLULLIB AZHȉD$xH0fD$~IB(H fL$|HHT$xEH H0fMfEuHAGGHHULLQtH0{LHD$ L6ILEDH]HT$xHAEAHt$ DD$pAEAH|H vH@HHHHHHLPDXL`DhLD$xLELELDL D(LDLDrjHoH;uHt H,/H]H=NH? HDuA0s'AH#FHFH@CLUABIz EA.rDG BE.D;rHWH@WL,Ǿ+DIҁ {H H03;s#DΉ|$ Lt0{I_LEoHIx3Ʉt\HEL(8Ht{I%{0At;8ItC0ҁ{Es{d8MotDD3HM!E3LcMLcEI LHcEL+EI L+ELII3ҋLIL+KHIEu tDDH_EHMHu9LEDLDILD$ +LRҁ{EuC0 Z EtE{0t'DC0HAIATǃ !SC0 [ǃ5}t5C0{0u \ǃ C ] {0t,HIuK0^ ǃHb HMHE4H$AHİA_A^A]A\_^]ffH; i8uHfuH2H() HH(HL$HH mdHYeHD$HE3HT$PHL$HHD$@H|$@tAHD$8HD$XHD$0HD$`HD$(HdHD$ LL$@LD$HHT$P3x"H$HdH$HHrdHdH%:ff@UHPHHP]@UH0HHEpHHH0]@UH0HHHHH0]@UH HtHE0H8t hH ]@UH HH ]@UH] } @} @`M@p@@M@N@P@P@L@p@@L@L@M@M@0S@p@@P @0@S@ V@@V@V@V@V@@@p@p@V@p@@W@X@X@ ^@p@@]@p@@@p@@Pu@y@y@`u@Pv@w@@y@|@p@@Pu@y@y@`u@Pv@w@@y@Pe@p@@Pu@y@y@`u@Pv@w@@y@c@p@@@p@@@@@@@@P@@p@ @@@p@@0@@V@V@@Q@Q@V@@p@@P @0@@ V@@V@V@Э@V@@@p@p@@p@@Pu@y@y@`u@Pv@w@@y@@@L@p@@@p@@P @0@ @@@V@V@@@@@p@p@P@p@@Pu@y@y@`u@Pv@w@@y@p@@`@p@@P @0@@ V@@V@V@@@@@p@p@@p@@Pu@y@y@`u@Pv@w@@y@@@L@@@@ @p@@P @P@V@p@@V@V@V@V@@@V@V@` @p@@:@K@`.@=@'@'@L@5@@p@@`@p@@pN@p@@0O@ r@p@@q@p@@S@p@@0i@o@V@`l@`Y@Z@Q@b@P@p@@@Q@pQ@V@V@@Q@Q@V@v@p@@x@p@@L@p@@ @p@@P@p@@L@p@@@p@@@p@@L@p@@@@@p@@0@@p@@@p@@p@@@p@@p@@p@@@p@@W@X@X@@p@@p@p@@@X@p@@@R@P@@@V@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@p@@p@P@P@@@@p@@`@p@@@X@p@@ @R@p@;@@V@@@&@0=@=@P=@p=@;@;@6@6@ 0@@7@V@p9@5@V@@V@V@V@V@5@P<@ =@`9@P9@V@5@5@V@=@p@@ >@P@>@=@[@p@@@>@p@@X@X@pY@X@pI@@V@X@@@pK@B@ a@p@@`f@@^@pU@n@p@@ s@p@@@@@P@`@@@p@@p@p@@@@^@pU@@@p@@@@^@pU@@p@@@ @@` @p@@@@^@pU@@p@@@p@@@@^@pU@P@p@@@ @p@@@p@@@@`@p@@L@p@@@@@0@@L@p@@@0@p@@0@p@@@p@@@p@@@@^@pU@p@p@@@p@@@@@P@`@@p@@0@p@@P@p@@@@^@pU@ @p@@W@X@@@0 @p@@'@p@@@*@p@@@@^@pU@P9@p@@@=@p@@A@p@@@@^@pU@@p@@@@@@@@`@`@p@@@L@p@@V@:@@ [@M@`@pe@T@0@@pr@z@0@@P@@@@@V@0+@04@5@ 8@Q@@p@@L@p@@@p@@@@^@pU@L@p@@p@p@@L@p@@L@0"@@L@p@@HE @XE @hE @xE @E @E @E @E @E @E @E @E @E @E @G @ @ @? @? @? @? @? @@ @@@ @@ @@ @@ @@ @A @(A @PA @`Q @; @; @; @6 6 7 (7 67 B7 N7 j7 7 7 7 7 7 7 7 8 8 ,8 :8 L8 b8 v8 8 8 8 8 8 9 .9 89 B9 P9 ^9 x9 9 9 9 9 9 9 9 9 9 : &: F: P: ^: l: ~: : : : : : : : : ; 6; H; l; ; ; ; ; ; < < F< V< l< < < < < < < < = 8= R= p= = = = = = > > 8> P> `> j> |> > > > > > ? ? &? 2? B? \? z? ? ? ? ? @ (@ D@ d@ z@ @ @ @ @ @ A *A JA hA A A A B 4B XB zB B B B B B C C (C 4C ^C vC C C C C C C C @ @CLLLM`MMNPP0SS VVVVWXX@Y] ^cPePu`uPvw@yyy|Pp @`0PЭp p0pPpP` P p@P`` ''`.45:=KLLpN0OP@QpQQQS`YZ0^b0i`loq rvx PpP0`p0@ppppPp@Pp` p& 05555667P9`9p9;;;P< =0=P=p====> >@>BXXXpY[ a`fn sP`@p@`  pU@^P p0`00p0P 0 '@*P9@=ARpIpKQ``p@p0"0+045 8:MT [`peprz0pP0@ \FRS_SCANORPHAN_FRSBAD_FRSVALIDATE_EAVALIDATE_REPARSEVALIDATE_INDEXRECOVER_ORPHAN_ORIGINAL_RECONNECTRECOVER_ORPHAN_LOSTFOUNDCOMPACT_SDVALIDATE_SDCHECK_DATAVALIDATE_USNRECOVER_USER_FILESRECOVER_FREE_SPACE%q\??\\\?\\device\:FATFAT32NTFS%W\BOOTEX.LOG\Registry\Machine\System\CurrentControlSet\ControlSystemStartOptionsSOSsosautocheck autochk SymbolicLink\Device\Volume\Device\HarddiskVolume{\??%d1234567890+-\Device\Setup0x%x-{}\Device\MountPointManager\??\Volume{-removable%x%I64x%x%I64d%x%x%I64x%x%x%I64x%x3Dh&%W%d\Device\KeyboardClass%d$I30EXFAT BEA01TEA01CDROMCD001CDW01CDW02NSR01NSR02BOOT2NSR03NTFS 5.0NTFS 4.0REFSOS/2 Boot ManagerUDFexFATRAW%SystemRoot%\UnknownScsiAtapiAta1394SsaFibreUsbRAIDiScsiSasSataSdMmc%d.%dUnknownCorrupt.onecore\base\fs\utils\ufat\src\fatvol.cxxDisableDeleteNotificationFileSystem%I64donecore\base\fs\utils\ifsutil\src\volume.cxx%02x %ws%ws%d%ddummyChkdsk%s\System Volume Information\Chkdsk\WVBackingStore%d.datonecore\base\fs\utils\ifsutil\src\wvcache.cxxProscanIoPrioritylownormalhighProscanMemoryPercentage%d%d%d%dTotalDefault%s-%s%W%q%q%q%q%q%q%q%q%q%q%q%qMaxWriteViewCacheSize%W%q%q%q%q%q%q%q%W%q%q%q%q%I64BootExecuteSession ManagerAutoChkTimeOutSystemPartition\Registry\Machine\System\Setup... . onecore\base\fs\utils\ufat\src\fatsa.cxxFAT16/12%s%uNO NAME MEMSTICK.INDMSTK_PRO.IND %10.1f%ws%13u%04X%04Xonecore\base\fs\utils\ufat\src\rfatsa.cxx%x%x%x%x%I64x%I64x%I64x%I64x%I64x%x%x%I64x$Infoonecore\base\fs\utils\untfs\src\upfile.cxx%x%x%xonecore\base\fs\utils\untfs\src\indxtree.cxx %W%d%I64donecore\base\fs\utils\untfs\src\frs.cxx%W%x%x%I64x%I64x%I64x%I64x%I64x%x%W%I64x%I64x%I64x$Q""$SDSonecore\base\fs\utils\untfs\src\frsstruc.cxx%x%x%I64x%x%x%x%I64x%X%W%X%x%I64x%x%I64x%x%x%I64x%I64x%I64x%d%W%I64x%x%x%x%x%I64x%x%x%x%x%x%I64xonecore\base\fs\utils\untfs\src\attrdef.cxx$STANDARD_INFORMATION@0H$ATTRIBUTE_LIST $FILE_NAME0BDB$OBJECT_ID@@$SECURITY_DESCRIPTORP$VOLUME_NAME`@$VOLUME_INFORMATIONp@ $DATA$INDEX_ROOT@$INDEX_ALLOCATION$BITMAP$REPARSE_POINT@$EA_INFORMATION@$EA$LOGGED_UTILITY_STREAM$STANDARD_INFORMATION@00$ATTRIBUTE_LIST $FILE_NAME0BDB$VOLUME_VERSION@@$SECURITY_DESCRIPTORP$VOLUME_NAME`@$VOLUME_INFORMATIONp@ $DATA$INDEX_ROOT@$INDEX_ALLOCATION$BITMAP$SYMBOLIC_LINK$EA_INFORMATION@$EA%x%I64x%I64x%I64xonecore\base\fs\utils\untfs\src\attrlist.cxx%x%x%x%x$TXF_DATA%I64x%x%x%x%x%x%x%x%x%I64x%I64x%x%x%I64x%I64x%I64x%x%xonecore\base\fs\utils\untfs\src\attrrec.cxx%x%x%I64x%I64x$Badonecore\base\fs\utils\untfs\src\badfile.cxxUNTFS: Log File $DATA attribute is resident. UNTFS: Can't read log file signature. onecore\base\fs\utils\untfs\src\logfile.cxxonecore\base\fs\utils\untfs\src\mftinfo.cxxonecore\base\fs\utils\untfs\src\mftref.cxx\Device%s\%sSystem Volume Informationonecore\base\fs\utils\ufat\src\fatsachk.cxxEA DATA. SF\EA DATA. SF%d%s%W%W????????.???%W%W%W%d%s%sFOUND.%03d..FILE%04d.CHK$UpCase$Quota$BadClus$Boot$Bitmap.$AttrDef$Volume$LogFile$MFTMirr$MFT%d%d%d%d%d%d%d%q%donecore\base\fs\utils\untfs\src\ntfschk.cxx%I64x%ws%ws%I64x%W$ObjId%d%W$O$Reparse$R$Quota$UsnJrnl%x%x%x%x%x%xAutochk cannot lock system volume due to a sharing violation. This is caused by a driver holding a file opened for write access. Check all newly added driver NtCreateFile and NtOpenFile calls or run: !FindAutochkBlockers From "kd" to list the files which may be preventing autochk from running. NTFS$SII$SDH%10u%10u%ubootsqm.datSpotFixProScanSystem Volume Information\Chkdsk%s%04d%02d%02d%02d%02d%02d%sbootex.logautochk%s:%I64u,TotalDuration:%I64u%W%q%x%x%I64x%x%I64x%I64x%x%x%W%x%W%I64x%X%W%I64X%x, %x$MFT$MFTMirr$LogFile$Volume$AttrDef$Bitmap$Boot$BadClus$Secure$UpCase$Extend...%2d%I64d%I64d$Verify$Corrupt$Extend$RmMetadata$Repair.log%d%W%donecore\base\fs\utils\untfs\src\sdchk.cxxValidateSDSStream%W%I64xRemoveUnusedSDs%I64x%W%dGarbageCollectSDSonecore\base\fs\utils\untfs\src\indxchk.cxxIndexValidationBuildMFTcacheValidateEntriesInIndexGatherRefCountsValidateEntriesInIndex2RefCountValidation%W%W%I64x%W%I64x%x%x%W%x%I64x%W%I64x%x%I64x%W%I64x%I64x%W%I64x%x%x%I64x%W%I64x%I64x%I64x%I64x%W%I64x%I64x%W%x%I64x%I64x%W%W%I64x%I64x%W%I64x%W%I64x%I64x%W%W%I64x%I64x%I64x%W%I64x%I64x%d%W%W%I64x%x%x%I64x%x%W%W%I64d%ddir%04d.chkfound.%03ddir_%08X.chkfile%08X.chk$Quota$ObjId$UsnJrnl$Reparse$Volumeonecore\base\fs\utils\untfs\src\rasd.cxxonecore\base\fs\utils\untfs\src\rafile.cxx$Maxonecore\base\fs\utils\untfs\src\usnjrnl.cxx$J%x%W%I64x%x%I64x%I64x%I64x%I64x%I64x%I64x%x%I64x\$Extend\$RmMetadata\$Repaironecore\base\fs\utils\untfs\src\spotfix.cxx<%#x,%#I64x>\ <%#x,%#I64x><???,%#I64x>???@@@\%s <%#x,%#I64x>SpotVerifyBadFRSOrphanChildFRSBadClusters%#I64x%#xBadFreeClusters%dCrossLink%W%W%W%WSDEntryInvalidSecurityIdIndexAttributeIndexSubtreeIndexOffsetIndexEntryIndexOrderIndexSortIndexCycleConnectBreakCycleFRSAllocateForceFullChkdskForceProactiveScanNoOpdefault?.?\$Extend\$Quota\$Extend\$ObjId\$Extend\$Reparse\$Extend\$UsnJrnl%d.%1d_[$ [  ETW0+ @[ChkdskVerbEncounteredchkdskVerbchkdskVerbSourceIdchkdskResult chkdskVerbDuration  @ChkdskRunInfoClusterSize ClusterCount SectorSizechkdskVolumeSize SystemClusters DirClusters FileClusters BadClusters FreeClusters chkdskVolumeGuidHiddenClusters EaSize  @ChkdskRunInfochkdskProgramNamechkdskVolumeSize chkdskHouseKeepingBitmaskchkdskArgumentsBitmaskchkdskVolumeGuidchkdskNumberUserFiles chkdskDuration @#ChkdskStageEnteredchkdskStage @ChkdskVerbEncounteredchkdskVerbchkdskVerbOutcomechkdskVerbOutcomeStatuschkdskVerbHeaderFlagschkdskVerbSourceIdchkdskVerbSignature chkdskVerbObjectId chkdskVerbDuration !%IHexEY9Microsoft-Windows-FileSystem-ChkdsksPOωGv!%IHexEY9Microsoft-Windows-FileSystem-ChkdsksPOωGvRSDSTy) Lz{Vautochk.pdbGCTL.text .text$mn .text$mn$00 .text$x P.rdata$brcP6 .idata$5; .00cfg; x.cfguard? .rdata8 .rdata$zETW0H .rdata$zETW1 .rdata$zETW2 .rdata$zETW9 .rdata$zzzdbg <6.xdata1 .idata$22 .idata$3(2 .idata$46  .idata$6P `.data$brc`Q +.data } .bss ..pdata @.rsrc$01@ P/.rsrc$02 $ $fp`0V  , ,4,p`P&4Pd tQdPN P td4P3 "t"d"4"Pd t4 P(4JFp`Pd  dT 4 rp' 't+'d*'4)'"Ptd 4  d#4  p P  p`0P202 p ` 0dT42pd42 pd 4Rpt d 4R  4 2p t d T 42 t dT42 d T 4 Rptd42 d T 42p d T 4 2pBp0BdT4p'<p`0Pd  .0d `bd T 4Rp bp ` P 0t4 P. dq4pj p Pd @ d4 p P! !4(!  p ` P4p`Pd p( T4 p `d p) T4 p `d p  4 2pd T 4 rp  4@ <p`P% %4%p`P4 p ` P' 't'd'4'P+t4 Pd  4 pd Pd &4pd p 4Rp`P" "d"4"pP0"4-(p`Pd 8T4 pB t d T 42 p ` P 0 T4 Rp` 4? <`d d42 p, 4E< p`Pd 0 4qf p`Pd  tdPdT 4 p20205 $t$d$4$ Pd P 4$td4d X  T4td T4* 44* p`Pd @% %4%p`Pd 4R p! !4!! p ` P! !4! p ` P4 Rp ` P$dO4NJ pd @ td4P d4 p P Pd `d `. d[4ZT p Pd +tV4UR Pd p`0d ht4 P  20 ;p`0d & 4 p`Pd '  p`0Pd "4)"p`Pd '2p`0Pd td4P42 p0 4od p`Pd 7 &th&dg&4f&`Pd  t d T 4 r td4P# #t #d#4#P 43 .pd `4P td4P   p`0V u7 7P4P 4p ` PBp ` P 0p`0V %j RP p`0V   p`0V i )   p`0  4S Npd `  4 Rpd T 4 rpR00 4@6 p`Pd  42 p`Pd 42 p d4r p P4 2 p`P d T 4 Rp$ $4$p`P dT4rpd 4R p 4r p ` P 48. p`P 4R p`P T4 p ` 4 p ` P" "p`0P d T 4 Rpt d4202p`0b p`0P 4;2 p`P p`P0 dT 4 Rp  4 2p p`P0B- 5 p`0Pd R p`0P 4 Rpd (  t T 4R 0d 1  p`0Pd p rp`P0d 0!4p`Pd %d/4.* Pd @$d04/, pd P p`P0d  *0d @ p`P0d H 4 rpd 84 p`Pd @ T 4 Rp` td4Pp`P0d42p p`0Prp0Pd42pr0d42 pd42p4P dT4p dT4p d T 4 p tT4 t d T 4R  td  td42 td4P* 4 p`Pd %t!4  Pd , d4 p Pd 0d @bd # #t#d#4#P& &p`0P4Pt d 4 r dT 4 rp tdT4 4Rp`P tdT4T 4 rp` 4 p ` P p`0d T 4 R p `d T R p% %4%%p`P$ $t9$d8$47$0Pr0/ !4! p ` Pd  4 p`P 4 p ` P) )4&)p`P  4 pT 4 Rp`  4 2p`P) )4,)$p`P) )4() p`P#dT4 pd @d T42p# #)#t(#d'#4&#"P# #t*#d)#4(#"PdT42 dT Rp t+d*" P T4 p `! !d!4! p P d T 4 Rp ,p`0d Pd T R p  td42T 42 p ` 4 p`P- t+d*4)$Pd  td4P! !4-!$ p ` P  p`0PT 4 2p`t dT24 R p`P4 p) )4%)p`P4r p ` P- I p`0Pd 0  4 Rp`P% %4 %p`P% %p`Prp`0P$ $4<$4 p ` PT 4 2 p `d 4 r p* 4-" p`Pd   t4, ,4J,Bp`P d T 42p# #t+#d)#4(#$P" "d+"4*"$pP- Q p`0Pd pT 4 Rp`& &44&,p`P tdT 4 r4P  4 p T 4 2p`4 p `Pt4 P$ $t5$d4$43$,P 4r p ` P! !4,!" p ` P4p ` P# ##t#d#4#P d T 4 p# #t#d#4#P dT4p! !4$! p ` P""p`0P d%4$ p P!!4.!*p`P td4PtdT  d Rpd 4  pd T  pd 4  p  4 2p`PT 4 Rp`2 p`P0d T 4 rpdT 4 pT4p`d4 p7 &t{&dz&4y&rPd 0 4vl p`Pd P+ +-p`0P-  p`0Pd   4 p  4 `d 4 r p4$ p`P% %4"%p`P# #t.#d-#4,#&P d T 4 Rp# #t"#d!#4 #P tdT44p`P$ $4$$p`P dT4p# #t#d#4#P 4+" p`P d T 4 Rp# #t!#d #4#P  p`0PdT4p 4 p ` P0 4A6 p`Pd & &t>&d=&4<&6P$ $4J$@ p ` P, ,4Y,Pp`P d342, p P( d-4,& p Pd 4p`P df4e` p P, 4:2 p`Pd dT4p4p`P2 !dP!4N!JpPd @%td4Pd X d#T"4 p d4 p P 20V   4 Rp`P R 0V ߓ4  4 rp T4 R p `  4 rpd4pP'  p`0Pd r p`0P 4 2p`PRp`0 4," p`P! !" ` 0 Pd T 4Rp- ? p`0Pd - -5p`0P& &t&d&4&P  4 Rp  4 rp tdT4 tdT 4 + +4R+Jp`P% %4%p`P! !4*!" p ` P T 4 Rp`d 4 R p 4Rp`P) d+T*4)&pd  t d T 4 R4rp`P& &p`0P% %4%Rp`P& &p`0P 4 p`P  4 p$ $p`0P% %4!%p`Pd pP p 0 P 4 p Pt4 Pd4 pd T 4 Rp4 r p `T 4 2p`4p# #t)#d(#4&#"P t!d P! !4!p`P  Bd4 p* 46, p`Pd P1 #t.#d-#4,#&Pd (d42p d)4($pP% %;p ` 0 P  pd 4 R p0 4XP p`Pd p( d*4)$ p Pd 6 %4?%4 p`Pd '  p`0Pd ' ! p`0Pd # #t(#d'#4&# P 4p`P* 4;0 p`Pd p' ' p`0Pd  4 Pd @-  p`0Pd 0 4<2 p`Pd # #%#t$#d##4"#P' / p`0Pd `0 4`V p`Pd * 47, p`Pd P3 " p`0Pd `# #T#4#`2 !h._ p`0Pd  T 4 2 p ` / p`0P- C p`0Pd & &dP&4N&HP-  p`0Pd @ d~4}x p P, ,4D,<p`P% %dl%4j%dpP$ $4_$V p ` P% %Yp ` 0 P0 4aX p`Pd ' - p`0Pd P-  p`0Pd 3 "U p`0Pd *2 !d\!4Z!T p Pd  tdT4 d 4 p P( (4}(tp`P! !4!p`P4 p`P 4g^ p`P-  p`0Pd 1 #t/#d-#4,#&Pd (0 "t"d"4"Pd x0 4=4 p`Pd ! !4 ! p ` P' '-p`0P# #t%#d$#4##P& &p`0Pp`0P t'd&" P( (t8(d7(46(0P0 4_T p`Pd " "d-"4,"&pPp`P0- -Up`0P) )9p`0P) )4+)"p`P" "d"4"pP- _ p`0Pd  d T 4 Rp td4P0 4 p`Pd * *t|*d{*tP1  p`0Pd `' 't''d$'P4 Rp`P d T 4 2pdU4TR p46 %4% p`Pd & &tn&dm&4l&fP0 4x p`Pd  4rp ` P 4 pd * 4# p`Pd  4p`P 4rp`P* *p`0P0 4 p`Pd %p`0Pd  d$4#pP t#d"4!P- -_p`0P$ p`0Pd X  20V 2 2Pd42 pV F\ 2 p`0V ~\ BV \ t d42V k\ 4V r P d T 4 2p-  p`0Pd -  p`0Pd ) )Kp`0P% %4-%$p`P!!Ap`0P$dI4HF pd 0 4z p`Pd 0 4| p`Pd -  p`0Pd , ,4,p`P$ $t4$d3$42$,P-  p`0Pd , ,4,p`P, ,4R,Hp`P& &t_&d^&4\&VP' + p`0Pd @0 4 p`Pd 0 4.& p`Pd  d4 p Ppd X t#d!4 P0dT4p t_d^T]4\Z t#d"4 P% %4&%p`P! ! p ` P Gp ` P 00 4d\ p`Pd ' 't+'d*'4('"P1  p`0Pd -  p`0Pd , ,4e,Zp`P T4rp`" "t{"dy"4x"tP( (4(p`P% %dj%4i%bpP!!Rp`P0 4 p`P 4p ` P M p`0P, d240* p Pd @& 46. p`Pd `) )p`0P) )=p`0P p 0 P) )t)d)P T 4p`- -p`0P* *t{*dz*4x*rP% %4%p`PdE4DB p0 4 p`Pd @5 #d%#T$#4"#pd ) )4!)p`P+ TB4@: p `d , 4B: p`Pd ( (4x(pp`P0 4 p`Pd P T 4 2p` d4 p P, ,4|,tp`P) )ep`0P- -ep`0P5 $4j$b p ` Pd - -Yp`0Ptd 4 Ptd4P( (4t(lp`P( (4(p`P# #d #T#4#p' 't$'d#'4"'P4p`P* *d*4*P5 $4$ p ` Pd , ,4x,pp`P0 4B8 p`Pd 0 4 p`Pd 00 4 p`Pd  td4P  R0, ,4v,lp`P0 4 p`Pd `td4 P 4 p`PB    "0(2 8 P6 6 6 7 (7 67 B7 N7 j7 7 7 7 7 7 7 7 8 8 ,8 :8 L8 b8 v8 8 8 8 8 8 9 .9 89 B9 P9 ^9 x9 9 9 9 9 9 9 9 9 9 : &: F: P: ^: l: ~: : : : : : : : : ; 6; H; l; ; ; ; ; ; < < F< V< l< < < < < < < < = 8= R= p= = = = = = > > 8> P> `> j> |> > > > > > ? ? &? 2? B? \? z? ? ? ? ? @ (@ D@ d@ z@ @ @ @ @ @ A *A JA hA A A A B 4B XB zB B B B B B C C (C 4C ^C vC C C C C C C C NtQuerySystemTimeNtOpenSymbolicLinkObjectRtlEqualUnicodeStringrNtWriteFilel_wcsicmpNtOpenKeyNtQuerySymbolicLinkObjectLdrSetMUICacheType!RtlInitUnicodeStringRtlPrefixUnicodeStringNtSerializeBootNtCloseNtOpenDirectoryObjectSNtFsControlFilewcsstrNtQueryDirectoryObjectNtCreateFileNtOpenFileNtQueryValueKeyTNtTerminateProcessRtlCaptureContextRtlLookupFunctionEntryRtlVirtualUnwindRtlUnhandledExceptionFilterntdll.dllRtlFreeAnsiStringRtlAllocateHeapRtlNormalizeProcessParamsRtlUnicodeStringToAnsiStringisspacememmoveg_vsnprintfi_vsnwprintfRtlMultiByteToUnicodeNRtlOemToUnicodeNRtlUnicodeToMultiByteNRtlUnicodeToOemNwcsspnz_wtoly_wtoi64t_wcsuprm_wcslwrwcschr5NtDeviceIoControlFileNtQueryInformationFileNtQueryVolumeInformationFilewcstouls_wcstoui64NtReadFileRtlRaiseStatusqsort*NtDelayExecutionNtQuerySystemInformationNRtlSizeHeapRtlFreeHeap8NtDrawTextswprintf_sNtCreateEvent@NtSetThreadExecutionStatekNtWaitForMultipleObjectsNtCancelIoFileRtlNumberGenericTableElementsAvlfRtlDosPathNameToNtPathName_URtlFreeUnicodeStringNtOpenProcessTokenNtAdjustPrivilegesTokenINtShutdownSystemRtlExpandEnvironmentStrings_U&NtSetInformationFileRtlValidRelativeSecurityDescriptorRtlGetVersionwRtlTimeToTimeFieldsMVerSetConditionMaskRtlVerifyVersionInfo7NtDisplayStringRtlQueryRegistryValuesExRtlRandomExNtQueryPerformanceCounterisprintRtlAcquireSRWLockExclusiveRtlReleaseSRWLockExclusiveyRtlEnterCriticalSectionRtlTryEnterCriticalSectiontRtlLeaveCriticalSectionBRtlDeleteCriticalSection3RtlInitializeSRWLock(RtlInitializeCriticalSectionPNtFreeVirtualMemoryNtSetEventRtlCaptureStackBackTraceNtAllocateVirtualMemorymNtWaitForSingleObjectNtResetEventwcsncmpRtlFindMessageRtlInitAnsiStringExRtlAnsiStringToUnicodeStringRtlFormatMessageuRtlLengthRequiredSid4RtlInitializeSidjRtlSubAuthoritySidwRtlLengthSidRtlCopySidRtlAddAce RtlCreateAclRtlQueryInformationAclRtlCreateSecurityDescriptor*RtlSetGroupSecurityDescriptor$RtlSetDaclSecurityDescriptorRtlNewSecurityObjectRtlValidSecurityDescriptorvRtlLengthSecurityDescriptorRtlAddAccessAllowedAce,RtlInitializeGenericTable6RtlInsertElementGenericTable%RtlInitializeBitMapRtlSetBitsRtlLookupElementGenericTableRtlClearBitsRtlFindSetBitsCRtlDeleteElementGenericTableRtlEnumerateGenericTableWithoutSplayingRtlNumberOfSetBits-RtlInitializeGenericTableAvl~RtlEnumerateGenericTableAvlRtlLookupFirstMatchingElementGenericTableAvlRtlEnumerateGenericTableWithoutSplayingAvlDRtlDeleteElementGenericTableAvlRtlLookupElementGenericTableFullAvl9RtlInsertElementGenericTableFullAvlERtlDeleteElementGenericTableAvlEx7RtlInsertElementGenericTableAvlRtlLookupElementGenericTableAvlRtlWriteRegistryValueoRtlSystemTimeToLocalTime RtlCrc64RtlUpcaseUnicodeStringRtlComputeCrc32!DbgPrintNtOpenThreadTokeno_wcsnicmp!RtlCreateSystemVolumeInformationFolderCEtwEventWriteTransfer"DbgPrintExGNtFlushBuffersFile/__C_specific_handler0__chkstkmemcmpmemcpymemsetwcscmp( @P@r @P@L@4@2-+] f =BG     >CH@ ?DI @EJ AFKe`meamebmecmeamedmeemefmegmfhmehmeimfkmflmfnm]fom^fpmeqmermesmetmermeumevmeeexmeymezme{me|me}me~mBfme~mememememNfmememfmfmemfm3fmfmememfmememememem,fmem-fmemem.fmemememfmemfmfmfm!fmKfmememKfmemfmfmfme~m{{ fxm~fmXMSWIN4.1 )NO NAME FAT32 3ɎѼ{ٽ|V@NV@AUrUu tF-V@sf@fр?AfffF~u9~*w3fFf ,}|tZUNTFSuAUr UuuhHXr; uۣ.Z3۹ +fK+wf#u-fTCPAu$rhhRh fSfSfUhfa3  f`fffhfPShhBfY[ZfYfYfufaá <t  A disk read error occurred BOOTMGR is compressed Press Ctrl+Alt+Del to restart UBOOTMGR$I30$NTLDRBOOTTGTBOOTNXT An operating system wasn't found. Try disconnecting any drives that don't contain an operating system.f f ffRf@fffRfff f3ffVfNf&ff*ff.ff>ffFff& f f2ff*w f6ff.e f:f2f gxgfPgBgfH fgfHfff f3fffFffJf>6f>:0f:f>Jf., f Bff"f fZf\ f xgff>>?f>f fff#f>ffff D'f3ff>f f>>f>ffff  gfX f fh f+f>h f+f> 6 +h Pf`ff ffff߃fPfag@gf8Lgf93f  gx #g:H fgp fQffYgfxgf@f+flgfg@ 4gfPg:J@gfrBIfQffYgxg@f3g{f`gfSgf fgrfafPgfSf gfJfAgfBf3f6Rff+f^f`g{ffafSfPfQfVfWff_f^fYf4f;ff+fff ff fffXff[fbfQfWgfC f ff+ffTfVgfs fff^fPfPgffPgfCfPgfV f ffqffZfYfBfQfV?ff^fYfNfffYfZfQfVfff^fYff_fYffXf[ff`&gf_&gfOf ffffIf &g&gfffIfaf`ff"fffffNf0f ffNfffVffNffQff fff ff>f3ff?_fSfGf&VfPf3f ffRf fVf ffZffNff f+f;fff+fZuffPf3f ffQfYf Vffffffff SffXfV,f^f f[f[fYfZf3f`fPfQf3f ffRfWSf_f  f ffZfffYf f;f+fXffPfQfXffPffQfW߃fPdf_f>RfYfXfpfaf`f&VfVUfaf`f&f6ff6*f>FfafPfSfQfJffffffgfYf[fXg{f+gfsgfVf; gff;f+g^f+g;>f9ff;!ffPgf ffffffCfXf+f+ff+f+g ff+fSfRfgffIfKf fgfKfIffZf[fSfRf+gff+g ff+fZf[ffgffIfKf fgfKfIffZf[f fQfVg>a g>zg. ff^fYfPfQff2gfXgCgf@fDf fYfYf6f fYfYf3f6gfRgfBf3f6f3fPfVfXf^f;:fVf@fPfHrfZf^fYf[fSfQfVfRfFgf@f tfYfYfYfYfYfYf3fQfPffff ff3f[fYffff3f3fffPfS#f[f_f 5ffffRfQf fff cff>f3YffYfZ&f9 &f9W1&f?/&&&fG؋%tˌ&fGfYfZf3fPfQffYQffYfX`i  a#EgܺvT2 `6 &GFf ` u[ 6 af`6 F2` u: X uf3fX f fff\  fff4 ufaf` fff` u ffWfwf fo   S fG[ff/fffffffffff3Gf3G f3G4ffG@ u > u ffWfwf fofaff3f#f3ff3f3fSff#ff#f ff#f f[èyZnܼbf`f3۸f#fTCPAfaf`g{ gfSgf %gfSgfJ(f gfB,f#f3f#2ff;f+fQfWfRffZf_fYf fTCPAf fff f3faf`f3۸f#tfTCPAiaffTCPAfff3fMBRChf|ffTCPAfBff3fMBRDhf|fǾfafRf3g{ gfSgf gfSgfB(fZf`fffhf fvfxf gff>>f>f fff#f>ffff Df3ff>f |f>>f>fffZf Rfff=?gfZ f.fh f+f>h f3g  faffaff`+& 227ž~ & h|hh|& faáicT ! !, ,- -"/$ (/L08 T04T 45x 57 79 9~< <> >Z@ `@C C'C( 0CC0 CD< DDP DE` EeF< lFGp $GtG |G%H ,HH HJ JJP KpK xKKP KpL LL( `MM MM( MmN< NO (OP PP$ PQ0 QHR PRS8 0SdS lSS( SVL VVh V'W( 0WWP WW| XX X+Y| @Yq[ x[]( ]^ ^o^ x^^( ^^( ^` `b bLc< TccP cd d8d( @dFe Pee ee( e.g 4gh hBo HoVr \r?u `uJv Pvw0 w0yP 8z!{p ({e{( l{J|P P||( |} }}( }}( ~~| ~~ ~L T ڄ( ޅ  $ $$ G8 PL Ȑd r| x| W| `o xD Lx( $ ,b( h֚ ; P cP ߜ( l 1 %( 0 F \( ( l t P ר  p( ŭ, ЭL D Lx( p V \߶ t | $]  v | , 4f l 8 pT xd i p" (  U \  p V \j  py@ \ Up    ] d# (   i( p( 0 < ` 0c p A( P (  c p= ,R ` p x( $( ~(  (   ^  dX  h k    I (  0 |  ( 0  $H ^  u` |P l ` P $ D L  \ dT ( ` b! h!<"( D"#p #& &' '{) )+ +L.0 `..L .V0\ \01 1{4 4v5P 5:t := =6? t D  $U \, 4    0 kD tS T \ Op X$T , k t p, & &. ..( ./ /0( 0u5 67 p9m;( ;?< l<=  ==( @>t> |>? $?<@ D@B, B%D ,DAI< HI\LX dL~M MN tNO OQt QQP QCR LRR RES( LSU UX XXd pYYd Zy[( [[ [_ _a( aTa \a>bP Dbc cUf `fg, gAmD HmRn` XnnP no oFo( Loox op pqL qr sTs \ss( st t0u 8uWv `vx x*{ 0{o~ x~ , H >` P>t D`d h L `% ,b he lB H8 @  $ < L Ũ ̨h 4 @t |ª( Ȫ(  ¬| Ȭ  \ d( 0. 4`( p  8( @y (  0(  H   ( (DP L \ x   $    $   < (L L l  + 4 z  7  @F L   28 8 L X h x y<  D L( (     K  T M  `    ( Q ( X F L? H    f l 8  B H\  5t 55 56 66 78 8= =9@ @@uA |A>E0 DE5FP  P (   Y `գ ܣ, 9@ @ӷ` ܷx  / 8ϻ ػ `( hB H % , P  T \P 0( 8  P D L( ( { [ p( ` 0d l( qP x 0d lP (  P  9 @h( p    d p ( (  ( b hL  d ly0 ( 4t <H X t Rp XCx L! 0d l( ( q xP   : @     0   H   | , @( P ( 6P <D ` $vt |P    e( l`  ( 0 d  l  ( t!< |!v"0 |"# #<$ D$$ $% %:& x&& '4' <'d'( l''( '(< (E) L)) @*y* *, ,- -m. t.B00 H07 77H 78P 8E9 P99( 9^<d d<2= @=t= |==( = >( >@ @A AAP A)B 0BuC |CRI XII I$K ,KL LO4 OO O-P` 4PQ QQP Q/RP 8RR R\ Ӎ ܍    * 0i p< AT HP P< XE Lp   w$ $( )) )bI pIgK< pKQT QSx SX X^[ d[` `{ {~! ~! 8! ȋyT! p! $ϖ! ؖ! Ț! ݠ ~!  " 0" SH" `$d" ,P" `g" p"  " U \s" | # 4# X# t t# | # # ## ,( 0# # $ $ $'0$ '*L$ *+ +6`$ 6Bx$ B{G$ G~J$ JU$ UBX$ HXY% Y^ ^f% fi@% it\% tx|% yy y{% {5|p <|^% d<% D % % & (& $XL& `d& |& .P @} ܠK ݥ& & & &  1 ' 8T $' <' T' P $_l' o x' V' \' ( $( P( Wx( `  ` h8(( @(?( ?HB( PBO( `P{i) i>j) DjZu4) `uX) 4) |) P k) t) ) ) * 0* DP* Lp* * * $ ,X( `* k* t * + C+ L^4+ d ) 0L+ ih+ p+ + + + W+ `, 8, "P, "'l, '), ))+, 0+#4 04~5, 58, 89, :w<- <=$- = ID- IL\- LMt- MsS- |SuT- T[- []- ]`- ``. `he. peCh@. Lhqlh. xl n. np. p[r prNy. Tyozt z. 4/ <( / 078/ @ T/ l/ S/ \// 8b/ hm/ /  e0 p³ ȳx 0 U@0 \z`0 C0 P}t0 0 0 0 00 L {1 y<1 T1 \1 > x1 D  1   1   1  / @  1    1 1 8 {   1 d    1     1   P     ,  2 V ' \ l ' r z p( 00 H`x      0(@ MUI Auto Check Utility i?Lv9PTRpSSXTTUWXZlZZ L\$o&. t0NDx p4psu{ \` bbdg**++,..$22!660::<::=::xA::B)<*<D>>EhBlBHrBtBJ!N!NxK4N8NK>NDNlLHNHNLRNVNVR%RW:RER$bUUdVVDeV)Ve,V0Vj2V3V6VHV Z ZZZ Z$Z'Z=ZtFZKZ4]]e f  f~fxiiij% j j "jj`mimkmlmnmmmmToao4oo0u2u8 uu uu0uuxuu&vv5vv5'w2w78wNw$JVw\w\`wwL^y/yl {{Ĺ{{@ {6{Xp{u{${{{|.|0|8|?|||' N' N< N N"N N0u NCu N`? NJ NT N N@ N NI NJ N, N N" N0 NX2 N N N Nx&XConvert lost chains to files (Y/N)? %0 LUnrecoverable error in folder %1. LConvert folder to file (Y/N)? %0 D %1 bytes total disk space. <%1 bytes in bad sectors. D%1 bytes in %2 hidden files. 8%1 bytes in %2 folders. 4%1 bytes in %2 files. H%1 bytes in %2 recovered files. L%1 bytes in %2 recoverable files. @%1 bytes available on disk. 8%1 total bytes memory. (%1 bytes free. xWindows cannot check a disk attached through a network. Windows cannot check a disk that is substituted or assigned using the SUBST or ASSIGN command. The specified disk appears to be a non-Windows XP disk. Updating FAT media type. An error occurred while reading the file allocation table (FAT %1). Folder %1. T%1 contains %2 non-contiguous blocks. PAll specified files are contiguous. Windows found errors on the disk, but will not fix them because disk checking was run without the /F (fix) parameter.  The file allocation table (FAT) on disk %1 is corrupted. %1 first allocation unit is not valid. The entry will be truncated. \File and folder verification is complete. PThe volume is too large to convert. The volume may have inconsistencies. Run Chkdsk, the disk checking utility.  An allocation error occurred. The file size will be adjusted. l Cannot recover .. entry, processing continued. X Folder is totally empty, no . or .. 4 Folder is joined. @ Cannot recover .. entry. XThe %1 entry contains a nonvalid link.  Windows has found an entry that contains a nonvalid attribute. XThe size of the %1 entry is not valid. \%1 is cross-linked on allocation unit %2.  Windows cannot find the %1 folder. Disk check cannot continue past this point in the folder structure.  The folder structure past this point cannot be processed. P%1 bytes of free disk space added. `%1 bytes of free disk space would be added. 8Volume %1 created %2 %3 P%1 total allocation units on disk. L%1 bytes in each allocation unit. `Disk checking is not available on disk %1. PA nonvalid parameter was specified. LThe specified path was not found. @The %1 file was not found. t %1 lost allocation units were found in %2 chains.  x The CHDIR command cannot switch to the root folder.  A disk error occurred during writing of the file allocation table. %1. %1 | The root folder on this volume is full. To perform a disk check, Windows requires space in the root folder. Remove some files from this folder, then run disk checking again. %1 %2 %3. %1 %2, %3. %1%2%3%4%5. %1%2%3%4. X%1 available allocation units on disk. Windows disk checking cannot fix errors (/F) when run from an MS-DOS window. Try again from the Windows XP shell or command prompt. HAn unspecified error occurred. <This never gets printed. dChecks a disk and displays a status report. CHKDSK [volume[[path]filename]]] [/F] [/V] [/R] [/X] [/I] [/C] [/L[:size]] [/B] [/scan] [/spotfix]  volume Specifies the drive letter (followed by a colon), mount point, or volume name.  filename FAT/FAT32 only: Specifies the files to check for fragmentation. h /F Fixes errors on the disk.  /V On FAT/FAT32: Displays the full path and name of every file on the disk. On NTFS: Displays cleanup messages if any. /R Locates bad sectors and recovers readable information (implies /F, when /scan not specified). /L:size NTFS only: Changes the log file size to the specified number of kilobytes. If size is not specified, displays current size. /X Forces the volume to dismount first if necessary. All opened handles to the volume would then be invalid (implies /F). /I NTFS only: Performs a less vigorous check of index entries. /C NTFS only: Skips checking of cycles within the folder structure. /B NTFS only: Re-evaluates bad clusters on the volume (implies /R) /scan NTFS only: Runs a online scan on the volume /forceofflinefix NTFS only: (Must be used with "/scan") Bypass all online repair; all defects found are queued for offline repair (i.e. "chkdsk /spotfix"). /perf NTFS only: (Must be used with "/scan") Uses more system resources to complete a scan as fast as possible. This may have a negative performance impact on other tasks running on the system. /spotfix NTFS only: Runs spot fixing on the volume /sdcleanup NTFS only: Garbage collect unneeded security descriptor data (implies /F). /offlinescanandfix Runs an offline scan and fix on the volume. /freeorphanedchains FAT/FAT32/exFAT only: Frees any orphaned cluster chains instead of recovering their contents. /markclean FAT/FAT32/exFAT only: Marks the volume clean if no corruption was detected, even if /F was not specified. The /I or /C switch reduces the amount of time required to run Chkdsk by skipping certain checks of the volume. To check the current disk, type CHKDSK with no parameters. Windows cannot run disk checking on CD-ROM and DVD-ROM drives. H Checking file system on %1 4The volume is clean. \Removing trailing folder entries from %1 tWindows replaced bad clusters in file %1 of name %2. The disk does not have enough space to replace bad clusters detected in file %1 of name %2. PWindows is verifying free space... TFree space verification is complete. \Windows is verifying files and folders... XWindows cannot upgrade this FAT volume. The specified volume name does not have a mount point or drive letter. 4The volume is dirty. Autochk cannot run due to an error caused by a recently installed software package. Use the system restore feature from the control panel to restore the system to a point prior to the recent software package installation. XAn unspecified error occurred (%1 %2). /SDCLEANUP can not be specified with /r, /b, /i, or /c options. X/PERF can be specified only with /SCAN. p/FORCEOFFLINEFIX can be specified only with /SCAN. Do you want to schedule Windows to check your disk the next time you start your computer? (Y/N) %0 Windows will check your disk the next time you start your computer.  Windows has finished checking your disk. Please wait while your computer restarts. hRemoving nonvalid long folder entry from %1... 0Now checking %1... \Removing orphaned long folder entry %1... \The log file size must be greater than 0. pWindows can set log file size on NTFS volumes only. pThe drive, the path, or the file name is not valid. 0%1 KB in %2 files. 4%1 KB in %2 folders. <%1 KB in %2 hidden files. H%1 KB in %2 recoverable files. D%1 KB in %2 recovered files. To skip disk checking, press any key within %1 second(s). %r%0 Disk checking has been cancelled. %b Windows will now check the disk. %b H%1 KB of free disk space added. \%1 KB of free disk space would be added. dThe /I option functions only on NTFS volumes. dThe /C option functions only on NTFS volumes. XWindows has finished checking the disk.  One of your disks needs to be checked for consistency. You may cancel the disk check, but it is strongly recommended that you continue. P A disk check has been scheduled. Windows was unable to determine if the specified volume is a system volume.  Windows has scanned the file system and found no problems. No further action is required.  Windows has made corrections to the file system. No further action is required.  Windows has checked the file system and found problems. Run CHKDSK with the /F (fix) option to correct these.  Windows found problems with the file system that could not be corrected. THIS IS AN EXPERIMENTAL VERSION OF CHKDSK. PLEASE USE IT ACCORDING TO THE GIVEN INSTRUCTIONS. The /I and /I:passes cannot be specified at the same time. tThe number of passes specified through /I is invalid. Windows cannot run disk checking on this volume because it is write protected. Windows cannot run disk checking on more than one volume of the same file system. To do so, please run CHKDSK from the command line. LError in writing the output log. Windows supports re-evaluating bad clusters on NTFS volumes only. lRemoving %1 clusters from the Bad Clusters File. Windows failed to remove clusters from the Bad Clusters File. Windows failed to remove clusters from the Bad Clusters File. Windows has fixed all previously identified issues with this drive. No further action is required. Windows could not fix all issues with this drive. Please run chkdsk /f to find and fix all problems with this drive. Windows has checked the file system and found problems. Please run chkdsk /scan to find the problems and queue them for repair. To skip disk checking, press any key within %1 second(s). %r%0 \%1 percent completed. %r%0 `Format complete. %b DInsert new disk for drive %1 @Reinsert disk for drive %1: \%1 percent completed.%2 %r%0 4Error in IOCTL call. TCannot open volume for direct access. `Error writing File Allocation Table (FAT). 4Error writing folder. HCannot format a network drive. <Parameters not supported. dInvalid media or Track 0 bad - disk unusable. <Error reading folder %1. Land press ENTER when ready... %0 `Enter current volume label for drive %1 %0 \Parameters incompatible with fixed disk. HError reading partition table. PParameters not supported by drive.   PInsert Windows XP disk in drive %1:  WARNING, ALL DATA ON NON-REMOVABLE DISK DRIVE %1 WILL BE LOST! Proceed with Format (Y/N)? %0 @ Format another (Y/N)? %0 HError writing partition table. @Parameters not compatible. X%1 allocation units available on disk. P %1 bytes in each allocation unit. DSame parameter entered twice. TMust enter both /t and /n parameters. Trying to recover allocation unit %1. %0 lVolume label is not supported with /8 parameter. 4Insufficient memory. H QuickFormat another (Y/N)? %0 Invalid existing format. This disk cannot be QuickFormatted. Proceed with unconditional format (Y/N)? %0 ,Formatting %1 KB ,Formatting %1 MB ,Formatting %1.%2M (Verifying %1 KB (Verifying %1 MB ,Verifying %1.%2M DSaving UNFORMAT information. HChecking existing disk format. 4QuickFormatting %1 KB 4QuickFormatting %1 MB 8QuickFormatting %1.%2M XFormats a disk for use with Windows. XFORMAT volume [/FS:file-system] [/V:label] [/Q] [/L[:state]] [/A:size] [/C] [/I:state] [/X] [/P:passes] [/S:state] FORMAT volume [/V:label] [/Q] [/F:size] [/P:passes] FORMAT volume [/V:label] [/Q] [/T:tracks /N:sectors] [/P:passes] \FORMAT volume [/V:label] [/Q] [/P:passes] FORMAT volume [/Q] volume Specifies the drive letter (followed by a colon), mount point, or volume name. /FS:filesystem Specifies the type of the file system (FAT, FAT32, exFAT, NTFS, UDF). d /V:label Specifies the volume label.  /Q Performs a quick format. Note that this switch overrides /P.  /C NTFS only: Files created on the new volume will be compressed by default.   /A:size Overrides the default allocation unit size. Default settings are strongly recommended for general use. NTFS supports 512, 1024, 2048, 4096, 8192, 16K, 32K, 64K. FAT supports 512, 1024, 2048, 4096, 8192, 16K, 32K, 64K, (128K, 256K for sector size > 512 bytes). FAT32 supports 512, 1024, 2048, 4096, 8192, 16K, 32K, 64K, (128K, 256K for sector size > 512 bytes). exFAT supports 512, 1024, 2048, 4096, 8192, 16K, 32K, 64K, 128K, 256K, 512K, 1M, 2M, 4M, 8M, 16M, 32M. Note that the FAT and FAT32 files systems impose the following restrictions on the number of clusters on a volume: FAT: Number of clusters <= 65526 FAT32: 65526 < Number of clusters < 4177918 Format will immediately stop processing if it decides that the above requirements cannot be met using the specified cluster size. NTFS compression is not supported for allocation unit sizes above 4096. /F:size Specifies the size of the floppy disk to format (1.44)  180, 320, 360, 640, 720, 1.2, 1.23, 1.44, 2.88, or 20.8). tAn incorrect volume label was entered for this drive.  /T:tracks Specifies the number of tracks per disk side.  /N:sectors Specifies the number of sectors per track. | /1 Formats a single side of a floppy disk.  /4 Formats a 5.25-inch 360K floppy disk in a high-density drive. p /8 Formats eight sectors per track. 0 /X Forces the volume to dismount first if necessary. All opened handles to the volume would no longer be valid. DCannot format a CD-ROM drive. HCannot format a RAM DISK drive. Please use the /FS switch to specify the file system you wish to use on this volume. (Format failed. hCannot format. This volume is write protected.  WARNING! The %1 file system is not enabled. Would you like to enable it (Y/N)? %0  The file system will be enabled when you restart the system. X FORMAT cannot enable the file system. xThe volume is too small for the specified file system. LCreating file system structures. %1 FORMAT does not support user selected allocation unit sizes. 0The device is busy. |The specified format cannot be mastered on 2.88MB drives. pFORMAT does not support the HPFS file system type. \Allocation unit size changed to %1 bytes. xAllocation unit size must be less than or equal to 64K. PNumber of clusters exceeds 32 bits. xCannot determine the number of sectors on this volume. %1 bad sectors were encountered during the format. These sectors cannot be guaranteed to have been cleaned.  /P:count Zero every sector on the volume. After that, the volume will be overwritten "count" times using a different random number each time. If "count" is zero, no additional overwrites are made after zeroing every sector. This switch is ignored when /Q is specified. DThe cluster size is illegal. xThe volume is too small for the requested cluster size. Cannot format with the allocation size %1. The default allocation size for the medium is %2.  /I:state ReFS only: Specifies whether integrity should be enabled on the new volume. "state" is either "enable" or "disable" Integrity is enabled on storage that supports data redundancy by default. <QuickFormatting %1 Bytes 4QuickFormatting %1 GB 4QuickFormatting %1 TB 4QuickFormatting %1 PB 4QuickFormatting %1 EB 0Formatting %1 Bytes ,Formatting %1 GB ,Formatting %1 TB ,Formatting %1 PB ,Formatting %1 EB 0Verifying %1 Bytes (Verifying %1 GB (Verifying %1 TB (Verifying %1 PB (Verifying %1 EB FORMAT volume [/Q] volume Specifies the drive letter (followed by a colon), mount point, or volume name. /FS:filesystem Specifies the type of the file system (FAT, FAT32, exFAT, NTFS, UDF, ReFS). \  /A:size Overrides the default allocation unit size. Default settings are strongly recommended for general use. ReFS supports 64K. NTFS supports 512, 1024, 2048, 4096, 8192, 16K, 32K, 64K. FAT supports 512, 1024, 2048, 4096, 8192, 16K, 32K, 64K, (128K, 256K for sector size > 512 bytes). FAT32 supports 512, 1024, 2048, 4096, 8192, 16K, 32K, 64K, (128K, 256K for sector size > 512 bytes). exFAT supports 512, 1024, 2048, 4096, 8192, 16K, 32K, 64K, 128K, 256K, 512K, 1M, 2M, 4M, 8M, 16M, 32M. Note that the FAT and FAT32 files systems impose the following restrictions on the number of clusters on a volume: FAT: Number of clusters <= 65526 FAT32: 65526 < Number of clusters < 4177918 Format will immediately stop processing if it decides that the above requirements cannot be met using the specified cluster size. NTFS compression is not supported for allocation unit sizes above 4096. /F:size Specifies the size of the floppy disk to format (1.44)  /A:size Overrides the default allocation unit size. Default settings are strongly recommended for general use. ReFS supports 64K. ReFS supports 4096, 64K. NTFS supports 512, 1024, 2048, 4096, 8192, 16K, 32K, 64K. FAT supports 512, 1024, 2048, 4096, 8192, 16K, 32K, 64K, (128K, 256K for sector size > 512 bytes). FAT32 supports 512, 1024, 2048, 4096, 8192, 16K, 32K, 64K, (128K, 256K for sector size > 512 bytes). exFAT supports 512, 1024, 2048, 4096, 8192, 16K, 32K, 64K, 128K, 256K, 512K, 1M, 2M, 4M, 8M, 16M, 32M. Note that the FAT and FAT32 files systems impose the following restrictions on the number of clusters on a volume: FAT: Number of clusters <= 65526 FAT32: 65526 < Number of clusters < 4177918 Format will immediately stop processing if it decides that the above requirements cannot be met using the specified cluster size. NTFS compression is not supported for allocation unit sizes above 4096. /F:size Specifies the size of the floppy disk to format (1.44)  Preinstallation completed successfully. Press any key to shut down/reboot.  Convert will take some time to process the files on the volume. When this phase of conversion is complete, the computer will restart. @%1 bits in each FAT entry. xWARNING! The cluster size chosen by the system is %1 bytes which differs from the specified cluster size. Proceed with Format using the cluster size chosen by the system (Y/N)? %0 WARNING! The cluster size chosen by the system is %1 bytes which differs from the specified cluster size. dThe specified cluster size is too big for %1. DThe volume is too big for %1. HThe volume is too small for %1. PFailed to write to the root folder. XFailed to initialize the volume label. hInitializing the File Allocation Table (FAT)... XWARNING! The cluster size for this volume, 64K bytes, may cause application compatibility problems, particularly with setup applications. The volume must be less than 2048 MB in size to change this if the default cluster size is being used. Proceed with Format using a 64K cluster (Y/N)? %0 WARNING! The cluster size for this volume, 64K bytes, may cause application compatibility problems, particularly with setup applications. The volume must be less than 2048 MB in size to change this if the default cluster size is being used. dEnvironmental variable FORMAT_SECTORS error.  Format cannot run because the volume is in use by another process. Format may run if this volume is dismounted first. ALL OPENED HANDLES TO THIS VOLUME WOULD THEN BE INVALID. Would you like to force a dismount on this volume? (Y/N) %0 HThere is no media in the drive. The given volume name does not have a mount point or drive letter. DInvalid drive specification. The given volume name does not have a mount point or drive letter. The specified cluster size is too small. The minimum valid cluster size value for this drive is %1. xFloppy disk is too small to hold the FAT32 file system. lNTFS file system is not supported on this device. hThe specified cluster size is too small for %1. TSet number of sectors on drive to %1. d /R:revision UDF only: Forces the format to a specific UDF version (1.02, 1.50, 2.00, 2.01, 2.50). The default revision is 2.01. This device cannot be formatted in quick mode. Proceed with unconditional format (Y/N)? %0 pCommunication failure with device. Format failed. DFormat failed due to timeout. This device cannot be formatted in quick mode. An unconditional format will be performed. This device requires proprietary format utility from manufacturer. WARNING! This device may not work properly if /A option is specified. Proceed (Y/N)? %0 WARNING! This device may not work properly since /A option is specified. XUnable to create the MEMSTICK.IND file. pFAT32 file system is not supported on this device. `This device does not support the /F option. lSystem Partition is not allowed to be formatted. dNTFS file system is not supported on this device optimized for removal. To change the way this device is optimized, select the Policies tab in the device's property sheet. tThe specified cluster size is invalid. Format failed. 0This disk can be QuickFormatted and does not need a unconditional format which can take a long time. Proceed with quick format instead (Y/N)? %0 8Blanking media ... HPerforming low level format ... \Windows cannot format this type of media. xFAT/FAT32 file system is not supported on this device. Floppy disks cannot be formatted with the UDF file system.  /D UDF 2.50 only: Metadata will be duplicated. The media cannot be formatted with the specified UDF version. UDF does not allow metadata duplication on UDF versions lower than 2.50 UDF does not allow metadata duplication on media that does not support writes in place. Floppy disks cannot be formatted with the eXFAT file system. Optical media cannot be formatted with the eXFAT file system. LThe API %1 failed with error %2. hThe API %1 processed the wrong number of bytes. PHeap allocation of %1 bytes failed. 0Unrecognized media. %1 A low-level format on this media may take a long time. The drive won't be usable during this period and it is recommended not to shutdown the machine until format is complete. Proceed with low level format (Y/N)? %0 Cluster size must be a multiplication of the physical sector size (%1 bytes). A hardware error occurred while formatting this disc. You can try again with a different disc, but if this problem persists, using the Live File System on this drive is not recommended. The Mastered option should be used instead. tThe "/s:" option accepts only "enable" or "disable".  /S:state Specifies support for short filenames (enable, disable) t Short names are enabled by default t Short names are disabled by default The "/R:" and "/D" options are only supported on the UDF file system. lReFS file system is not supported on this device. t /L[:state] NTFS Only: Overrides the default size of file record. By default, a non-tiered volume will be formatted with small size file records and a tiered volume will be formatted with large size file records. /L and /L:enable forces format to use large size file records and /L:disable forces format to use small size file records. tThe "/I:" option accepts only "enable" or "disable".  /TrNH NTFS and ReFS Only: For volumes with tiered storage, causes Heat gathering to be disabled. This volume is configured for use only by the ReFS file system. L /DAX[:state] NTFS Only: Enable direct access storage (DAX) mode for this volume. In DAX mode, the volume is accessed via the memory bus, boosting IO performance. A volume can be formatted with DAX mode only if the hardware is DAX capable. State can specify "enable" or "disable". /DAX is considered as /DAX:enable. The device is not DAX capable. Try formatting without DAX support. XThe "/L" option can only be used once. tThe "/L:" option accepts only "enable" or "disable".  /TXF:state Specifies txf is enabled/disabled (enabled, disabled) ` TxF is enabled by default d TxF is disabled by default xThe "/DAX:" option accepts only "enable" or "disable". \The "/DAX" option can only be used once. DAX is not supported on MBR partitioned disk. Try formatting without DAX support or repartition the disk with GPT. DAX is supported only on GPT data partition. Try formatting without DAX support. pCannot lock the drive. The volume is still in use. <Cannot read boot sector. DVolume Serial Number is %1-%2 lVolume label (11 characters, ENTER for none)? %0 PInvalid characters in volume label pThere are no readable file allocation tables (FAT). lSome file allocation tables (FAT) are unreadable. <Cannot write boot sector. pSome file allocation tables (FAT) are unwriteable. <Insufficient disk space. 8%1 KB total disk space. 4%1 KB are available. HDisk not formatted or not FAT. DRequired parameter missing - PThe type of the file system is %1. @The new file system is %1. XAn error occurred while running Format. P%1 is not available for %2 drives. \Cannot determine file system of drive %1. @Cannot dismount the drive. @%1 is not a complete name. Yes No 8Disk is not formatted. HSpecified drive does not exist. 8Invalid parameter - %1 (Out of memory. 0Access denied - %1 Access Denied as you do not have sufficient privileges. You have to invoke this utility running in elevated mode. @Cannot lock current drive. 4Invalid volume label The disk is too large to format for the specified file system. lVolume label (32 characters, ENTER for none)? %0 \ Chkdsk cannot run because the volume is in use by another process. Would you like to schedule this volume to be checked the next time the system restarts? (Y/N) %0  Chkdsk could not schedule this volume to be checked the next time the system restarts.  This volume will be checked the next time the system restarts. TCompression is not available for %1. \Cannot enable compression for the volume. Compression is not supported on volumes with clusters larger than 4096 bytes. <Cannot unlock the drive.  Chkdsk cannot run because the volume is in use by another process. Chkdsk may run if this volume is dismounted first. ALL OPENED HANDLES TO THIS VOLUME WOULD THEN BE INVALID. Would you like to force a dismount on this volume? (Y/N) %0 Volume dismounted. All opened handles to this volume are now invalid.  Chkdsk cannot dismount the volume because it is a system drive or there is an active paging file on it. Would you like to schedule this volume to be checked the next time the system restarts? (Y/N) %0 8%1 MB total disk space. 4%1 MB are available. The volume is in use by another process. Chkdsk might report errors when no corruption is present. 8The device is offline. lThe target of the symbolic link %1 does not exist lThe target volume does not support symbolic links The media being formatted has been removed or has become invalid. Format aborted. LUDF version %1 is not supported. BitLocker encryption on the volume could not be removed. Format aborted. BitLocker encryption and the encrypted data on the volume has been removed. You may enable BitLocker again after formatting is complete. Label too big -- volume labels must be 32 or fewer characters. 8%1 GB total disk space. 4%1 GB are available. 8%1 TB total disk space. 4%1 TB are available. 8%1 PB total disk space. 4%1 PB are available. 8%1 EB total disk space. 4%1 EB are available. @%1 bytes total disk space. 8%1 bytes are available. xShort file name enable/disable is not available for %1. PIntegrity is not available for %1. XCannot enable integrity for the volume. lErrors in file allocation table (FAT) corrected. tExtended attribute file has handle. Handle removed. Extended attribute file contains no extended attributes. File deleted. 8Erasing invalid label. L%1 bytes in extended attributes. Unreadable extended attribute header. Cannot check extended attribute log. Extended attribute log is unintelligible. Ignore log and continue? (Y/N) %0 Unused, unreadable, or unwriteable portion of extended attribute file removed. Total size entry for extended attribute set at cluster %1 corrected. Need count entry for extended attribute set at cluster %1 corrected. Extended attribute file is unsorted. Sorting extended attribute file. Insufficient space in extended attribute file for its header. Attempting to allocate more disk space. Insufficient disk space to correct disk error. Please free some disk space and run CHKDSK again. |Bad clusters in extended attribute file header relocated. pErrors in extended attribute file header corrected. tMore than one dot entry in folder %1. Entry removed. hDot entry found in root folder. Entry removed. pDot-dot entry found in root folder. Entry removed. Dot entry in folder %1 has incorrect link. Link corrected. Dot-dot entry in folder %1 has incorrect link. Link corrected. tMore than one %1 entry in folder %2. Entry removed. Folder %1 causes cycle in folder structure. Folder entry removed. Folder %1 has bad clusters. Bad clusters removed from folder. |Folder %1 is entirely unreadable. Folder entry removed. %1 ,Folder truncated. HCross link resolved by copying. Insufficient disk space to copy cross-linked portion. File being truncated. \%1 Invalid name. Folder entry removed. 8%1 Invalid time stamp. P%1 Folder has non-zero file size. `%1 Unrecognized extended attribute handle. %1 Has handle extended attribute set belonging to another file. Handle removed. Unused extended attribute set with handle %1 deleted from extended attribute file. Extended attribute set with handle %1 owner changed from %2 to %3. lBad links in lost chain at cluster %1 corrected. |Lost chain cross-linked at cluster %1. Orphan truncated. dInsufficient disk space to recover lost data. dInsufficient disk space to recover lost data. LError in extended attribute log. P%1 Errors in . and/or .. corrected. More than one %1 entry in folder %2. Renamed to %3 but still could not resolve the name conflict. tMore than one %1 entry in folder %2. Renamed to %3. X%1 may be an invalid name in folder %2. HCorrected name %1 in folder %2. 0Invalid media byte. DRepaired extended attributes. 0Bad sectors found. Detected minor inconsistencies on the drive. This is not a corruption. hCleaning up minor inconsistencies on the drive. Creates, changes, or deletes the volume label of a disk. LABEL [drive:][label] LABEL [/MP] [volume] [label] drive: Specifies the drive letter of a drive. label Specifies the label of the volume. /MP Specifies that the volume should be treated as a mount point or volume name. volume Specifies the drive letter (followed by a colon), mount point, or volume name. If volume name is specified, the /MP flag is unnecessary. HVolume in drive %1 has no label <Volume in drive %1 is %2 X Delete current volume label (Y/N)? %0 Cannot change label on this volume. The request is not supported. DInvalid drive specification. The given volume name does not have a mount point or drive letter. tCannot change label. This volume is write protected. Volume label cannot be added because the root directory on this volume is full. HVolume label change cancelled. 0File not found - %1 0Path not found - %1 HParameter format not correct - HNot resetting system file - %1 HNot resetting hidden file - %1 Displays or changes file attributes. ATTRIB [+R | -R] [+A | -A ] [+S | -S] [+H | -H] [+I | -I] [drive:][path][filename] [/S [/D] [/L]] + Sets an attribute. - Clears an attribute. R Read-only file attribute. A Archive file attribute. S System file attribute. H Hidden file attribute. I Not content indexed file attribute. X No scrub file attribute. V Integrity attribute. [drive:][path][filename] Specifies a file or files for attrib to process. /S Processes matching files in the current folder and all subfolders. /D Processes folders as well. /L Work on the attributes of the Symbolic Link versus the target of the Symbolic Link 0Invalid switch - %1 0Access denied - %1 HUnable to change attribute - %1 hThe /D switch is only valid with the /S switch. 4Invalid switch - /%1 ,Invalid path - %1 8No subfolders exist %1 0Folder PATH listing LFolder PATH listing for volume %1 DVolume serial number is %1-%2 LVolume serial number is %1 %2:%3 Graphically displays the folder structure of a drive or path. TREE [drive:][path] [/F] [/A] /F Display the names of the files in each folder. /A Use ASCII instead of extended characters. LParameter format not correct - %1 <Too many parameters - %1 @Invalid drive specification 0Not enough memory. FIND: %0 PFIND: Incorrect Windows XP version 4FIND: Invalid switch PFIND: Parameter format not correct Searches for a text string in a file or files. FIND [/V] [/C] [/N] [/I] [/OFF[LINE]] "string" [[drive:][path]filename[ ...]] /V Displays all lines NOT containing the specified string. /C Displays only the count of lines containing the string. /N Displays line numbers with the displayed lines. /I Ignores the case of characters when searching for the string. /OFF[LINE] Do not skip files with offline attribute set. "string" Specifies the text string to find. [drive:][path]filename Specifies a file or files to search. If a path is not specified, FIND searches the text typed at the prompt or piped from another command. LFIND: Required parameter missing 0File not found - %1 %1 0 ---------- %1: %2 ( ---------- %1 %1 [%1]%2 0Insufficient memory 0Unable to read file Files with offline attribute were skipped. Use /OFFLINE for not skipping such files. 0 Compares two files or sets of files and displays the differences between them FC [/A] [/C] [/L] [/LBn] [/N] [/OFF[LINE]] [/T] [/U] [/W] [/nnnn] [drive1:][path1]filename1 [drive2:][path2]filename2 FC /B [drive1:][path1]filename1 [drive2:][path2]filename2 /A Displays only first and last lines for each set of differences. /B Performs a binary comparison. /C Disregards the case of letters. /L Compares files as ASCII text. /LBn Sets the maximum consecutive mismatches to the specified number of lines. /N Displays the line numbers on an ASCII comparison. /OFF[LINE] Do not skip files with offline attribute set. /T Does not expand tabs to spaces. /U Compare files as UNICODE text files. /W Compresses white space (tabs and spaces) for comparison. /nnnn Specifies the number of consecutive lines that must match after a mismatch. [drive1:][path1]filename1 Specifies the first file or set of files to compare. [drive2:][path2]filename2 Specifies the second file or set of files to compare. @FC: Incompatible Switches 4FC: Invalid Switch lFC: Insufficient number of file specifications <Comparing files %1 and %2 dFC: cannot open %1 - No such file or folder %1 %2 Could not expand second file name so as to match first LFC: no differences encountered <Comparing files %1 and %2 <File(s) not found : %1 %1 %1: %2 ***** %1 ***** <FC: %1 longer than %2 \Resync Failed. Files are too different. FC: Unable to open %1. File unavailable for read access. PFC: Incorrect Windows XP Version ...  ... %1: %2 %3 ,FC: Out of memory Files with offline attribute were skipped. Use /OFFLINE for not skipping such files. Compares the contents of two files or sets of files. COMP [data1] [data2] [/D] [/A] [/L] [/N=number] [/C] [/OFF[LINE]] data1 Specifies location and name(s) of first file(s) to compare. data2 Specifies location and name(s) of second files to compare. /D Displays differences in decimal format. /A Displays differences in ASCII characters. /L Displays line numbers for differences. /N=number Compares only the first specified number of lines in each file. /C Disregards case of ASCII letters when comparing files. /OFF[LINE] Do not skip files with offline attribute set. To compare sets of files, use wildcards in data1 and data2 parameters. 0Files compare OK 8No memory available. @Can't find/open file: %1 4Can't read file: %1 <Bad command line syntax @Bad numeric argument: %1 hCompare error at %1 %2 file1 = %3 file2 = %4 LName of first file to compare: %0 PName of second file to compare: %0 Option: %0 8Comparing %1 and %2... DFiles are different sizes. HFormat for /n switch is /n=XXXX DCompare more files (Y/N) ? %0 %1 %2 Could not expand second file name so as to match first L10 mismatches - ending compare HIncorrect Windows XP version <Unexpected end of file 4Invalid switch - %1 @ File1 only has %1 lines @ File2 only has %1 lines *.*%0 OFFSET%0 LINE%0 Files with offline attribute were skipped. Use /OFFLINE for not skipping such files. , File not found d Cannot RECOVER an ASSIGNed or SUBSTed drive D Invalid drive or file name L Cannot RECOVER a network drive 8 %1 file(s) recovered. @ %1 of %2 bytes recovered. | Press ENTER to begin recovery of the file on drive %1 h Cannot read the file allocation table (FAT). h Cannot write the file allocation table (FAT).  Recovers readable information from a bad or defective disk. HRECOVER [drive:][path]filename ,RECOVER drive: Consult the online Command Reference in Windows Help before using the RECOVER command. $Write error. @Internal consistency error. Read error. RECOVER on an entire volume is no longer supported. To get equivalent functionality use CHKDSK. NTFS RECOVER has detected that the volume is corrupt. Run CHKDSK /f to fix it. NTFS Recover could not write elementary disk structures. The volume may be corrupt; run CHKDSK /f to fix it. Files on this volume cannot be recovered with this version of UNTFS.DLL. NTFS RECOVER cannot be used to recover system files. Use CHKDSK instead. 4NTFS RECOVER failed. 0Invalid switch - %1 DSwitch %1 is not implemented ,No file to print HUnable to initialize device %1 0Can't find file %1 D%1 is currently being printed Prints a text file. PRINT [/D:device] [[drive:][path]filename[...]] /D:device Specifies a print device. Provides help information for Windows XP commands. HELP [command] command - displays help information on that command. HHelp file could not be found. @Error reading help file.  For more information on a specific command, type HELP command-name. This command is not supported by the help utility. Try "%1 /?". HIncorrect Windows XP version (--- MORE ---%0 4Insufficient memory. MORE%0 8-- More %1%2%3 -- %4%0 (%1%%)%0 $[Line: %1]%0 H[Options: psfq=<space><ret>]%0 Lines: %0 P%0 S%0 =%0 Q%0 ?%0 H%0 F%0 Displays output one screen at a time. MORE [/E [/C] [/P] [/S] [/Tn] [+n]] < [drive:][path]filename command-name | MORE [/E [/C] [/P] [/S] [/Tn] [+n]] MORE /E [/C] [/P] [/S] [/Tn] [+n] [files] [drive:][path]filename Specifies a file to display one screen at a time. command-name Specifies a command whose output will be displayed. /E Enable extended features /C Clear screen before displaying page /P Expand FormFeed characters /S Squeeze multiple blank lines into a single line /Tn Expand tabs to n spaces (default 8) Switches can be present in the MORE environment variable. +n Start displaying the first file at line n files List of files to be displayed. Files in the list are separated by blanks. If extended features are enabled, the following commands are accepted at the -- More -- prompt: P n Display next n lines S n Skip next n lines F Display next file Q Quit = Show line number ? Show help line <space> Display next page <ret> Display next line (Internal error. PToo many arguments in command line. 0Not enough memory. 4Cannot access file %1 8Invalid registry entry. $Replacing %1 Adding %1 0%1 file(s) replaced ,%1 file(s) added ,No files replaced (No files added HPress any key to continue . . . 4Replace %1? (Y/N) %0 ,Add %1? (Y/N) %0 Replaces files. REPLACE [drive1:][path1]filename [drive2:][path2] [/A] [/P] [/R] [/W] REPLACE [drive1:][path1]filename [drive2:][path2] [/P] [/R] [/S] [/W] [/U] [drive1:][path1]filename Specifies the source file or files. [drive2:][path2] Specifies the directory where files are to be replaced. /A Adds new files to destination directory. Cannot use with /S or /U switches. /P Prompts for confirmation before replacing a file or adding a source file. /R Replaces read-only files as well as unprotected files. /S Replaces files in all subdirectories of the destination directory. Cannot use with the /A switch. /W Waits for you to insert a disk before beginning. /U Replaces (updates) only files that are older than source files. Cannot use with the /A switch. <Incorrect Windows version 4Source path required LFile cannot be copied onto itself 8Insufficient disk space 0No files found - %1 ,Extended Error %1 (Parse Error %1 $Out of memory 0Invalid switch - %1 DInvalid parameter combination 0Path not found - %1 0Access denied - %1 The /Z and /O (or /X) options conflict: cannot copy security in restartable mode. 0Insufficient memory 8Invalid parameter - %1 $Invalid path DCannot perform a cyclic copy $Invalid date @Unable to create directory @Invalid drive specification PCannot XCOPY from a reserved device $Access denied 0Too many open files (General failure ,Sharing violation (Lock violation (Path not found 8Insufficient disk space LFile cannot be copied onto itself DInvalid number of parameters HUnable to create directory - %1 0File not found - %1 <File creation error - %1 (Invalid switch hInvalid Path, not all directories/files copied ,Extended Error %1 Parse Error TWrite protect error accessing drive. 0Invalid switch - %1 XCopies files and directory trees. XCOPY source [destination] [/A | /M] [/D[:date]] [/P] [/S [/E]] [/V] [/W] [/C] [/I] [/Q] [/F] [/L] [/G] [/H] [/R] [/T] [/U] [/K] [/N] [/O] [/X] [/Y] [/-Y] [/Z] [/B] [/J] [/EXCLUDE:file1[+file2][+file3]...] source Specifies the file(s) to copy. destination Specifies the location and/or name of new files. /A Copies only files with the archive attribute set, doesn't change the attribute. /M Copies only files with the archive attribute set, turns off the archive attribute. /D:m-d-y Copies files changed on or after the specified date. If no date is given, copies only those files whose source time is newer than the destination time. /EXCLUDE:file1[+file2][+file3]... Specifies a list of files containing strings. Each string should be in a separate line in the files. When any of the strings match any part of the absolute path of the file to be copied, that file will be excluded from being copied. For example, specifying a string like \obj\ or .obj will exclude all files underneath the directory obj or all files with the .obj extension respectively. /P Prompts you before creating each destination file. /S Copies directories and subdirectories except empty ones. /E Copies directories and subdirectories, including empty ones. Same as /S /E. May be used to modify /T. /V Verifies the size of each new file. /W Prompts you to press a key before copying. /C Continues copying even if errors occur. /I If destination does not exist and copying more than one file, assumes that destination must be a directory. /Q Does not display file names while copying. /F Displays full source and destination file names while copying. /L Displays files that would be copied. /G Allows the copying of encrypted files to destination that does not support encryption. /H Copies hidden and system files also. /R Overwrites read-only files. /T Creates directory structure, but does not copy files. Does not include empty directories or subdirectories. /T /E includes empty directories and subdirectories. /U Copies only files that already exist in destination. /K Copies attributes. Normal Xcopy will reset read-only attributes. /N Copies using the generated short names. /O Copies file ownership and ACL information. /X Copies file audit settings (implies /O). /Y Suppresses prompting to confirm you want to overwrite an existing destination file. /-Y Causes prompting to confirm you want to overwrite an existing destination file. /Z Copies networked files in restartable mode. /B Copies the Symbolic Link itself versus the target of the link. /J Copies using unbuffered I/O. Recommended for very large files. The switch /Y may be preset in the COPYCMD environment variable. This may be overridden with /-Y on the command line. pPress any key when ready to begin copying file(s)%0 $%1 (Y/N)? %0 Does %1 specify a file name or directory name on the target (F = file, D = directory)? %0 ,%1 File(s) copied %1 -> %2  Insufficient disk space on current disk. Insert another disk and type <Return> to continue... %0 F%0 D%0 Y%0 N%0 %1 File(s) <File verification failed. A%0 DOverwrite %1 (Yes/No/All)? %0 XFile path is too long to be displayed. Insufficient privilege to perform the operation or access denied. 0Encryption failed. Security Information not supported by destination file system. (Unknown error. Source directory may be changing. XCOPY may not be able to copy all files or directories within the directory. <Insufficient stack space. 0%1 -> %2 (Y/N)? %0 LPathname exceeded 256 characters. \Source pathname exceeded 256 characters. dDestination pathname exceeded 256 characters. <LPT%1: rerouted to COM%2: TActive code page for device %1 is %2 Configures system devices. Serial port: MODE COMm[:] [BAUD=b] [PARITY=p] [DATA=d] [STOP=s] [to=on|off] [xon=on|off] [odsr=on|off] [octs=on|off] [dtr=on|off|hs] [rts=on|off|hs|tg] [idsr=on|off] Device Status: MODE [device] [/STATUS] Redirect printing: MODE LPTn[:]=COMm[:] Select code page: MODE CON[:] CP SELECT=yyy Code page status: MODE CON[:] CP [/STATUS] Display mode: MODE CON[:] [COLS=c] [LINES=n] Typematic rate: MODE CON[:] [RATE=r DELAY=d] 8Status for device *:%0 8 Baud: %1 8 Parity: %1 8 Data Bits: %1 8 Stop Bits: %1 8 Timeout: %1 8 XON/XOFF: %1 8 CTS handshaking: %1 8 DSR handshaking: %1 8 DSR sensitivity: %1 8 DTR circuit: %1 8 RTS circuit: %1 8 Lines: %1 8 Columns: %1 8 Code page: %1 x Printer output is being rerouted to serial port %1 \ Printer output is not being rerouted. 8 Keyboard rate: %1 8 Keyboard delay: %1 To change printer settings use the Printers option in Control Panel PIncorrect operating system version <Illegal device name - %1 @Invalid baud rate specified ,%1: not rerouted 8Invalid parameter - %1 DInvalid number of parameters DFailure to access device: %1 lCode page operation not supported on this device lCurrent keyboard does not support this code page $Out of memory Parse Error ,Extended error %1 The specified options are not supported by this serial device The screen cannot be set to the number of lines and columns specified. The device cannot be set to the specified number of lines and/or columns. `Cannot stop printer rerouting at this time. pCannot reroute printer output to serial device %1. 4Invalid keyboard rate 8Invalid keyboard delay The number of lines and columns cannot be changed in a full screen. TThe code page specified is not valid. XThe specified option is not supported. 8Default to even parity. <Default to %1 data bits. <Default to %1 stop bits. HNo serial port setting changed. This operation is not necessary under the current version of Windows. TDevice %1 is not currently available. The first NTFS boot sector is unreadable or corrupt. Reading second NTFS boot sector instead. All NTFS boot sectors are unreadable or corrupt. Cannot continue. `The second NTFS boot sector is unwriteable. `The first NTFS boot sector is unwriteable. |All NTFS boot sectors are unwriteable. Cannot continue. xThe NTFS file system does not function on floppy disks. \Deleting corrupt file record segment %1. Deleting corrupt attribute record (0x%1, %2) from file record segment 0x%3. Truncating badly linked attribute records from file record segment %1. tSorting attribute records for file record segment %1. Deleting duplicate attribute records (%1, %2) from file record segment %3. `Deleted corrupt attribute list for file %1. hDeleted unreadable attribute list for file %1. Deleted corrupt attribute list entry with type code %1 in file %2. hTruncating corrupt attribute list for file %1. PSorting attribute list for file %1. hUnreadable master file table. CHKDSK aborted. `Corrupt master file table. CHKDSK aborted. Corrupt Attribute Definition Table. CHKDSK is assuming the default. Unable to determine volume version and state. CHKDSK aborted. TFile record segment %1 is unreadable. XDeleting orphan file record segment %1. Insufficient disk space to hotfix unreadable system file %1. CHKDSK Aborted. tInsufficient disk space to hotfix unreadable file %1. First free byte offset corrected in file record segment %1. |Correcting errors in the Master File Table (MFT) mirror. Insufficient disk space to repair master file table (MFT) mirror. CHKDSK aborted. hInsufficient disk space to record bad clusters. Correcting errors in the master file table's (MFT) DATA attribute. Insufficient disk space to fix master file table (MFT). CHKDSK aborted. Correcting errors in the master file table's (MFT) BITMAP attribute. Insufficient disk space to fix volume bitmap. CHKDSK aborted. XCorrecting errors in the Volume Bitmap. tCorrecting errors in the Attribute Definition Table. Insufficient disk space to fix the attribute definition table. CHKDSK aborted. `Correcting errors in the Bad Clusters File. Insufficient disk space to fix the bad clusters file. CHKDSK aborted. PCorrecting errors in the Boot File. Insufficient disk space to fix the boot file. CHKDSK aborted. lAdding %1 bad clusters to the Bad Clusters File. < %1 KB total disk space. 0%1 KB in %2 files. 4%1 KB in %2 indexes. 4%1 KB in bad sectors. @%1 KB in use by the system. @%1 KB available on disk. \Correcting error in index %2 for file %1. Insufficient disk space to correct errors in index %2 of file %1. TRemoving corrupt index %2 in file %1. LDeleting directory entries in %1 pCHKDSK cannot delete all corrupt directory entries. LCHKDSK is recovering lost files. |Insufficient disk space for CHKDSK to recover lost files. LCorrecting error in directory %1 DSorting index %2 in file %1. tCorrecting extended attribute information in file %1. pDeleting corrupt extended attribute set in file %1. `Incorrect duplicate information in file %1. XCHKDSK is creating new root directory. tInsufficient disk space to create new root directory. |Recovering orphaned file %1 (%2) into directory file %3. dInsufficient disk space to recover lost data. TToo much lost data to recover it all. Fixing critical master file table (MFT) files with MFT mirror. xFixing incorrect information in file record segment %1. Corrupt uppercase Table -- aborting. Run "chkdsk /f" to repair. Cannot retrieve current system uppercase table. CHKDSK aborted. CHKDSK discovered free space marked as allocated in the master file table (MFT) bitmap. CHKDSK discovered free space marked as allocated in the volume bitmap. \Correcting errors in the uppercase file. Insufficient disk space to fix the uppercase file. CHKDSK aborted. hDeleting index entry %3 in index %2 of file %1. dVerbose output not supported by NTFS CHKDSK.  WARNING! /F parameter not specified. Running CHKDSK in read-only mode.  Errors found. CHKDSK cannot continue in read-only mode. Correcting cycles in directory tree. Breaking links between parent file %1 and child file %2. dCorrecting minor file name errors in file %1. XInserting data attribute into file %1. |Insufficient disk space to insert missing data attribute. PCorrecting errors in the Log File. Insufficient disk space to fix the log file. CHKDSK aborted. h CHKDSK is verifying files (stage %1 of %2)... l CHKDSK is verifying indexes (stage %1 of %2)... DIndex verification completed. DFile verification completed.  CHKDSK is verifying security descriptors (stage %1 of %2)... `Security descriptor verification completed. Replacing missing or invalid security descriptor for file %1. Insufficient disk space for security descriptor for file %1. This volume cannot be checked with this version of UNTFS.DLL. lDeleting an index entry from index %2 of file %1. PCorrecting cross-link for file %1. p CHKDSK is verifying file data (stage %1 of %2)... LFile data verification completed. Index entries referencing file %1 will not be validated because this file contains too many file names. `CHKDSK is resetting recovery information... LCHKDSK is resetting the log file. dCHKDSK is adjusting the size of the log file. tCHKDSK was unable to adjust the size of the log file. XCleaning up instance tags for file %1. Fixing corrupt attribute record (%1, %2) in file record segment %3. H%1 KB occupied by the log file. lReadable file record segment %1 is not writeable. |Inserting default quota record into index %2 in file %1. XCreating a default security descriptor. \Unable to set the quota out of date flag. lRepairing an index entry in index %2 of file %1. pInserting an index entry into index %2 of file %1. Insufficient disk space to fix the security descriptors data stream. `Unable to write to attribute %1 of file %2. tUnable to read the security descriptors data stream. Fixing mirror copy of the security descriptors data stream. tFixing collation rule value for index %1 of file %2. HCreating index %1 for file %2. `Repairing the security file record segment. Repairing the unreadable security descriptors data stream. pInsufficient disk space to fix the object id file. hInsufficient disk space to fix the quota file. <Creating object id file. 4Creating quota file. \Fixing flags for file record segment %1. dUnable to correct an error in system file %1. XUnable to create index %1 for file %2. Replacing invalid security id with default security id for file %1. |Multiple quota files found. Ignoring extra quota files. Multiple object id files found. Ignoring extra object id files. hThe size specified for the log file is too big. The current log file size is %1 KB. The default log file size for this volume is %2 KB. CHKDSK discovered free space marked as allocated in the bitmap for index %2 for file %1. lThe size specified for the log file is too small. %1%2. Correcting file name errors in system file record segment %1. Inserting an index entry with Id %3 into index %2 of file %1. Deleting an index entry with Id %3 from index %2 of file %1. Cleaning up %3 unused index entries from index %2 of file %1. Repairing an index entry with id %3 in index %2 of file %1. \Correcting sparse file record segment %1. Deleting extended attribute set due to the presence of reparse point in file %1. lCorrecting reparse point file record segment %1. dCorrecting encrypted file record segment %1. Multiple Usn Journal file found. Ignoring extra Usn Journal files. tInsufficient disk space to fix the Usn Journal file. @Creating Usn Journal file. PCHKDSK is verifying Usn Journal... PCreating Usn Journal %1 data stream Insufficient disk space to fix the Usn Journal %1 data stream. TRepairing Usn Journal %1 data stream. hUnable to read the Usn Journal %1 data stream. `Repairing Usn Journal file record segment. PUsn Journal verification completed. XCHKDSK is resetting Usn information... lThis version of NTFS volume cannot be downgraded. xCHKDSK is determining if the volume is downgradeable... DThe volume is downgradeable. PCHKDSK is downgrading the volume... pVolume downgraded. %b hReparse point found in file record segment %1. xEncrypted data stream found in file record segment %1. pSparse data stream found in file record segment %1. TUnable to change the volume version. HUnable to downgrade the volume. xUpdating the master file table's (MFT) DATA attribute. |Updating the master file table's (MFT) BITMAP attribute. @Updating the Volume Bitmap. Upgrading and downgrading the volume at the same time will have no effect. dProperty set found in file record segment %1. Multiple reparse file found. Ignoring extra reparse files. xInsufficient disk space to fix the reparse point file. DCreating reparse point file. Missing object id index entry or duplicate object id detected for file record segment %1. pInsufficient disk space to insert the index entry. LWARNING! /I parameter specified. LWARNING! /C parameter specified. Your drive may still be corrupt even after running CHKDSK. < %1 MB total disk space. 0%1 MB in %2 files. 4%1 MB in %2 indexes. 4%1 MB in bad sectors. @%1 MB in use by the system. @%1 MB available on disk. HUnable to set chkdsk ran flag. @Deleting USN Journal file. t CHKDSK is verifying free space (stage %1 of %2)... |Deleting duplicate object id from file record segment %1. dUnable to create a thread with error code %1. %1 PUnable to collect logged messages. `Unable to obtain a handle to the event log. Failed to transfer logged messages to the event log with status %1. 0Volume label is %1. PUnable to set chkdsk ran once flag. TUnable to clear chkdsk ran once flag. `Cleaning up %1 unused security descriptors. Detected minor inconsistencies on the drive. This is not a corruption. hCleaning up minor inconsistencies on the drive. PReplacing bad clusters in logfile. The deleting of the USN Journal is in progress. Skipping USN Journal verification. CHKDSK was unable to adjust the size of the log file due to too much fragmentation within the volume. CHKDSK was unable to adjust the size of the log file. Please use the /f parameter as well. TAttribute list found in the log file. There is not enough disk space to enlarge the logfile to the specified size. There is not enough disk space to enlarge the logfile to the default size. TThe current logfile size is too big. %1 MB of additional physical memory is needed to enable windows to check your disk at full speed. xIndex verification stage will be split into %1 passes. Windows is checking your disk with a slower index verification algorithm as commanded. Index verification stage cannot be split into %1 passes. It will be reduced. XThere are too many files and directories on this volume for windows to check your disk at full speed. Make sure the allowed user address space is set to a maximum. ,An attempt to split the index verification stage into %1 or less passes has failed. Windows will not be able to check your disk at full speed. Windows cannot adjust the size of the log file due to possible corruption. Please run CHKDSK with the /F (fix) option to correct these. lDeleted invalid filename %1 (%3) in directory %2. File %1 has been orphaned since all its filenames were invalid Windows will recover the file in the orphan recovery phase. There are too many files and directories on this volume for windows to check your disk at full speed. Windows may not detect all cycles on your volume because the directory structure is too deep. Windows cannot recover master file table. CHKDSK aborted. Unreadable master file table. Windows will attempt to recover master file table from disk. Corrupt master file table. Windows will attempt to recover master file table from disk. Chkdsk was executed in read-only mode on a volume snapshot. %1 hChkdsk was executed in read-only mode. A volume snapshot was not used. Extra errors and warnings may be reported as the volume may have changed during the chkdsk run. %1 dChkdsk was executed in read/write mode. %1 The "/L" option cannot be specified with the "/F" option. Only the "/L:<size>" option may be used with the "/F" option. To display the log file size, use "CHKDSK /L" with no other options. CHKDSK is scanning unindexed files for reconnect to their original directory. hCHKDSK is recovering remaining unindexed files. Insufficient memory for full index scan. Disabling index cycle analysis. Creating default security descriptor for undefined security ID %1. Security ID %1 was referenced in one or more file records but was not defined in the security descriptor stream. The "/verify" option cannot be specified with the "/F" option. The "/scan" option cannot be specified with the "/verify" option. The "/verify" option cannot be specified with the "/spotfix" option. The "/scan" option cannot be specified with the "/spotfix" option. pSkipping further messages about recovering orphans. Chkdsk was executed in scan mode on a volume snapshot. %1 Chkdsk was executed in spotfix mode on a read-write volume. %1 Chkdsk was executed in verify mode on a volume snapshot. %1 A snapshot error occured while scanning this drive. You can try again, but if this problem persists, run an offline scan and fix. A snapshot error occured while scanning this drive. Run an offline scan and fix. Read-only chkdsk found bad on-disk uppercase table - using system table. This operation can not be performed on a read-only volume. Chkdsk scan speed is being throttled to reduce impact on system and application performance. Given the number of files and directories on the drive, Windows can scan the drive more efficiently if it has more memory available. To enable Chkdsk to use all available system memory and increase scan performance, please use the /perf switch. pRepairing invalid filename %1 (%3) in directory %2. Deleting invalid system file name %1 (%3) in directory %2. Repairing invalid system file name %1 (%3) in directory %2. hCorrecting system file name errors in file %1. Correcting total allocated size in attribute record (%1, %2) of file %3. Volume has 0x%1 file record segments which is more than 32 bits. |The file name index present bit is not set for file 0x%1. tThe view index present bit is not set for file 0x%1. dThe system file bit is not set for file 0x%1. XThe %2 index is missing from file 0x%1. EA Information is incorrect. Actual On Disk PackedEaSize 0x%1 0x%4 NeedEaCount 0x%2 0x%5 UnpackedEaSize 0x%3 0x%6 ,The EA INFORMATION attribute is not consistency with the EA DATA attribute for file 0x%1. EA INFORMATION equals 0x%2 while EA DATA equals 0x%3. lThe EA INFORMATION is not readable for file 0x%1. The EA INFORMATION size, 0x%2, in file 0x%1 is incorrect. The expected size is 0x%3. `The EA DATA is not readable for file 0x%1. The EA DATA size, 0x%2, in file 0x%1 is incorrect. The expected size is 0x%3. %1%2 Corrupt EA set for file 0x%1. The remaining length, 0x%2, is too small. Corrupt EA set for file 0x%1. The unpacked total length, 0x%2, is larger than the total data length, 0x%3. Corrupt EA set for file 0x%1. The EA name is of length 0x%2. Corrupt EA set for file 0x%1. The unpacked length, 0x%2, is not the same as the record length, 0x%3. The EA Information value length, 0x%1, in file 0x%2 is incorrect. The EA total packed length, 0x%2, is too large in file 0x%1. The second MFT starting LCN in the boot sector is incorrect. The actual value is 0x%2 while the expected value is 0x%1. The reparse point length, 0x%1, has exceeded a maximum of 0x%2. The reparse point length, 0x%1, is less than a minimum of 0x%2. \Unable to read reparse point data buffer. Only 0x%1 bytes returned from a read of 0x%d bytes of the reparse data buffer. ReparseDataLength, 0x%1, inconsistence with the attribute length 0x%2. TReparse Tag, 0x%1, is a reserved tag. `File 0x%1 has bad reparse point attribute. Both reparse point and EA INFORMATION attributes exist in file 0x%1. The attribute definition table length, 0x%1, is not divisible by 0x%2. |Unable to find child frs 0x%1 with sequence number 0x%2. Unable to locate attribute of type 0x%1, lowest vcn 0x%2, instance tag 0x%3 in file 0x%4. The is an attribute list attribute within the attribute list in file 0x%1. The lowest vcn, 0x%2, is not zero for attribute of type 0x%1 and instance tag 0x%3 in file 0x%4. The lowest vcn, 0x%2, is not zero for attribute of type 0x%1 in file 0x%3. The first attribute of type 0x%1 and instance tag 0x%2 in file 0x%3 should not be resident. The attribute of type 0x%1 and instance tag 0x%2 in file 0x%3 should not be resident. The attributes with instance tags 0x%2 and 0x%4 have different type codes 0x%1 and 0x%3 respectively in file 0x%5. DThe attributes with same type code 0x%1 but different instance tags 0x%2 and 0x%4 have non-contiguous VCN numbers 0x%3 and 0x%5 respectively in file 0x%6. $The attributes with same type code 0x%1 but different instance tags 0x%2 and 0x%4 have different names %3 and %5 respectively in file 0x%6. The attribute of type 0x%1 and instance tag 0x%2 in file 0x%5 has allocated length of 0x%3 instead of 0x%4. The attribute of type 0x%1 in file 0x%4 has allocated length of 0x%2 instead of 0x%3. The file attributes flag 0x%1 in file 0x%3 is incorrect. The expected value is 0x%2. pThe sequence number 0x%1 in file 0x%2 is incorrect. The total allocated size 0x%3 of attribute of type 0x%1 and instance tag 0x%2 in file 0x%5 is incorrect. The expected value is %4. Read failure with status 0x%1 at offset 0x%2 for 0x%3 bytes. Incorrect read at offset 0x%1 for 0x%3 bytes but got 0x%2 bytes. Write failure with status 0x%1 at offset 0x%2 for 0x%3 bytes. Incorrect write at offset 0x%1 for 0x%3 bytes but wrote 0x%2 bytes. The data written out is different from what is being read back at offset 0x%1 for 0x%2 bytes. The file 0x%1 belongs to parent 0x%3 but got 0x%2 as parent. tThe file 0x%1 has file name %2 when it should be %3. The multi-sector header with total size 0x%1, USA offset 0x%2, and USA count 0x%3 is incorrect. The USA check value, 0x%2, at block 0x%1 is incorrect. The expected value is 0x%3. Unable to query LCN from VCN 0x%2 for attribute of type 0x%1. Attribute record of type 0x%1 and instance tag 0x%2 is cross linked starting at 0x%3 for possibly 0x%4 clusters. Attribute record of type 0x%1 is cross linked starting at cluster 0x%2 for possibly 0x%3 clusters. The attribute list in file 0x%1 does not contain standard information attribute. The attribute list in file 0x%1 indicates the standard information attribute is outside the base file record segment. `The index root %2 is missing in file 0x%1. dThe index bitmap %2 is missing in file 0x%1. hThe index bitmap %2 in file 0x%1 is incorrect. The index bitmap %2 is present but there is no corresponding index allocation attribute in file 0x%1. The length, 0x%2, of the root index %1 in file 0x%4 is too small. The minimum length is 0x%3. The root index %1 in file 0x%3 is incorrect. The expected name is %2. The collation rule 0x%3 for index root %1 in file 0x%2 is incorrect. The expected value is 0x%4. Breaking the parent 0x%1 and child 0x%2 file relationship. This also makes the child an orphan. The index attribute of type 0x%2 for index root %1 in file 0x%4 is incorrect. The expected value is 0x%3. tThe index %1 is not a known quota index in file 0x%2. |The index %1 is not a known security index in file 0x%2. The index attribute of type 0x%2 for index root %1 in file 0x%3 is not recognized. The index attribute of type 0x%2 for index root %1 in file 0x%3 is not indexable. The bytes per index buffer, 0x%2, for index root %1 in file 0x%4 is incorrect. The expected value is 0x%3. The clusters per index buffer, 0x%2, for index root %1 in file 0x%4 is incorrect. The expected value is 0x%3. The index allocation value length, 0x%2, for index %1 in file 0x%4 is not in multiple of 0x%3. The index allocation allocated length, 0x%2, for index %1 in file 0x%4 is not in multiple of 0x%3. The first free byte, 0x%2, and bytes available, 0x%3, for root index %1 in file 0x%4 are not equal. The index entry offset, 0x%3, of index %1 and VCN 0x%2 in file 0x%4 is incorrect. The index entry offset, 0x%2, of index %1 in file 0x%3 is incorrect. The bytes available, 0x%2, in index header for index %1 in file 0x%4 is not equal to 0x%3. The index header for index %1 and VCN 0x%2 in file 0x%3 is not marked as index node. pThe VCN 0x%2 of index %1 in file 0x%3 is incorrect. The index bitmap for index %1 in file 0x%2 is invalid or missing. |The VCN 0x%2 of index %1 in file 0x%3 is already in use. The index allocation for index %1 in file 0x%2 is invalid or missing. The multi-sector header signature for VCN 0x%2 of index %1 in file 0x%3 is incorrect. The USA offset 0x%3 of VCN 0x%2 of index %1 in file 0x%5 is below 0x%4. The VCN 0x%2 of index %1 in file 0x%4 is inconsistence with the VCN 0x%3 stored inside the index buffer. The bytes per block, 0x%3, read from index buffer of VCN 0x%2 of index %1 in file 0x%4 is incorrect. The USA offset 0x%3 of VCN 0x%2 of index %1 in file 0x%4 is incorrect. The USA size 0x%3 of VCN 0x%2 of index %1 in file 0x%5 is incorrect. The expected value is 0x%4. The index header of index %1 in file 0x%2 is marked as index node when it should not. The first free byte, 0x%2, in index header of index %1 in file 0x%4 is not equal to 0x%3. Unable to query the name of a file name index entry of length 0x%3 of index %2 in file 0x%4 with parent 0x%1. Index entry %3 of index %2 in file 0x%1 points to unused file 0x%4. An index entry of index %2 in file 0x%1 points to unused file 0x%3. The file 0x%4 pointed to by index entry %3 of index %2 with parent file 0x%1 is not a base file record segment. The file 0x%3 pointed to by an index entry of index %2 with parent file 0x%1 is not a base file record segment. Unable to locate the file name attribute of index entry %3 of index %2 with parent 0x%1 in file 0x%4. Unable to locate the file name attribute of an index entry of index %2 with parent 0x%1 in file 0x%3. The object id index entry in file 0x%1 points to file 0x%2 but the file has no object id in it. The object id index entry in file 0x%1 points to file 0x%2 which is not a base file record segment. The object id in index entry in file 0x%1 is incorrect. The entry points to file 0x%2. The parent 0x%2 in an object id index entry in file 0x%1 is incorrect. The correct value is 0x%3. The object id in file 0x%2 already existed in the object id index in file 0x%1. The object id in file 0x%2 does not appear in the object id index in file 0x%1. The reparse point index entry in file 0x%1 points to file 0x%2 which is not a base file record segment. The reparse tag 0x%2 of reparse point index entry in file 0x%1 is incorrect. The correct reparse tag in file 0x%4 is 0x%3. The parent 0x%2 in the reparse point index entry with tag 0x%4 in file 0x%1 is incorrect. The correct value is 0x%3. The reparse point index entry in file 0x%1 points to file 0x%2 but the file has no reparse point in it. The reparse point in file 0x%2 does not appear in the reparse point index in file 0x%1. The file name index present bit is set in file 0x%1 but there is no file name index. tThe root index %2 in file 0x%1 is missing or invalid. The index entry length 0x%1 is incorrect. The maximum value is 0x%2. The index entry attribute length 0x%2 of index entry type 0x%1 is incorrect. The correct length is 0x%3. The index entry data offset 0x%1 and length 0x%2 is inconsistence with the index entry length 0x%3. The index entry length is incorrect for index entry type 0x%1. The index entry length is too small for index entry type 0x%1. The volume information attribute is missing from file 0x%1. The attribute record length 0x%1 is too small for attribute of type 0x%3 and instance tag 0x%4. The minimum value is 0x%2. The attribute form code 0x%1 is invalid for attribute of type 0x%2 and instance tag 0x%3. The attribute of type 0x%1 and instance tag 0x%2 should be resident. The standard information attribute length 0x%1 is incorrect. The expected value is 0x%2 or 0x%3. Attribute name is not allowed for attribute of type 0x%1 and instance tag 0x%2. The attribute of type 0x%1 and instance tag 0x%2 should not be resident. The attribute name offset for attribute of type 0x%1 and instance tag 0x%2 is incorrect. The attribute name for attribute of type 0x%1 and instance tag 0x%2 contains unicode NULL. tUnknown attribute of type 0x%1 and instance tag 0x%2. The attribute of type 0x%1 and instance tag 0x%2 should not be indexed. The attribute of type 0x%1 and instance tag 0x%2 should be indexed. The indexable attribute of type 0x%1 and instance tag 0x%2 should not have name. The attribute of type 0x%1 and instance tag 0x%2 should have a name. The attribute length 0x%1 for attribute of type 0x%3 and instance tag 0x%4 is too small. The minimum value is 0x%2. The attribute length 0x%1 for attribute of type 0x%3 and instance tag 0x%4 is too big. The maximum value is 0x%2. lThe resident attribute for attribute of type 0x%4 and instance tag 0x%5 is incorrect. The attribute has value of length 0x%1, and offset 0x%2. The attribute length is 0x%3. The resident attribute name is colliding with the resident value for attribute of type 0x%4 and instance tag 0x%5. The attribute name offset is 0x%2, length 0x%1, and the attribute value offset is 0x%3. The mapping pairs offset 0x%1 for attribute of type 0x%3 and instance tag 0x%4 exceeded the attribute length 0x%2. The mapping pairs offset 0x%1 for attribute of type 0x%3 and instance tag 0x%4 is too small. The minimum value is 0x%2. The attribute name is colliding with the mapping pairs for attribute of type %4 and instance tag 0x%5. The attribute name offset is 0x%2, length 0x%1, and the mapping pairs offset is 0x%3. The attribute of type 0x%1 and instance tag 0x%2 has bad mapping pairs. Unable to initialize an extent list for attribute type 0x%1 with instance tag 0x%2. The highest VCN 0x%1 of attribute of type 0x%3 and instance tag 0x%4 is incorrect. The expected value is 0x%2. @The non resident attribute of type 0x%4 and instance tag 0x%5 is inconsistent. The valid data length is 0x%1, file size 0x%2, and allocated length 0x%3. The non resident attribute of type 0x%4 is inconsistent. The valid data length is 0x%1, file size 0x%2, and allocated length 0x%3. The allocated length 0x%1 is not in multiple of 0x%2 for attribute of type 0x%3 and instance tag 0x%4. The file name value length 0x%1 for attribute of type 0x%3 with instance tag 0x%4 is too small. The minimum value is 0x%2. The attribute of type 0x%2 and instance tag 0x%3 is inconsistence. The attribute value length is 0x%1. The file name length is zero for attribute of type 0x%1 and instance tag 0x%2. The file name in file name value in attribute of type 0x%1 and instance tag %2 contains unicode NULL. The multi-sector header signature in file 0x%1 is incorrect. The USA offset 0x%1 in file 0x%3 is too small. The minimum value is 0x%2. The file record segment size 0x%1 is invalid in file 0x%2. hThe USA offset 0x%1 in file 0x%2 is incorrect. The USA size 0x%1 in file 0x%3 is incorrect. The expected value is 0x%2. The first attribute offset 0x%1 in file 0x%2 is incorrect. The bytes available, 0x%1, in the file record segment header for file 0x%3 is incorrect. The expected value is 0x%2. The instance tag 0x%2 of attribute of type 0x%1 in file 0x%3 is already in use. The instance tag 0x%2 of attribute of type 0x%1 in file 0x%4 is too large. The instance tag should be less than 0x%3. The standard information attribute in file 0x%1 is missing. The attribute record offset 0x%1 is too large for attribute of type 0x%3 and instance tag 0x%4 in file 0x%5. The maximum value is 0x%2. The record length of attribute of type 0x%1 and instance tag 0x%2 in file 0x%3 should not be zero. The record length 0x%1 of attribute of type 0x%2 and instance tag 0x%3 in file 0x%4 is not aligned. The record length 0x%1 is too large for attribute of type 0x%3 and instance tag 0x%4 in file 0x%5. The maximum value is 0x%2. 0The first free byte, 0x%1, in file 0x%4 is incorrect. The number of bytes free in the file record segment is 0x%2 and the total length is 0x%3. The attribute of type 0x%1 and instance tag 0x%2 should be after attribute of type 0x%3 and instance tag 0x%4 in file 0x%5. All attribute of type 0x%1 and instance tag 0x%2 should be indexed in file 0x%5. Two identical attributes of type 0x%1 and instance tag 0x%2 are in file 0x%3. The file name index present bit in file 0x%1 should not be set. The sparse flag in standard information attribute in file 0x%1 is not set. The old encrypted flag is being replaced by the new encrypted flag in file 0x%1. The encrypted flag in standard information attribute in file 0x%1 is not set. The reparse flag in standard information attribute in file 0x%1 is not set. The reparse flag in standard information attribute in file 0x%1 should not be set. There are more than one NTFS file name attribute in file 0x%1. The file name attributes in file 0x%3 has different parents. The DOS name has 0x%1 as parent. The NTFS name has 0x%2 as parent. There are more than one DOS file name attribute in file 0x%1. xThe DOS file name attribute in file 0x%1 is incorrect. pThere is no NTFS file name attribute in file 0x%1. lThere is no DOS file name attribute in file 0x%1. The DOS and NTFS file name attributes in file 0x%1 are identical. lUnable to setup the attribute list in file 0x%1. The attribute type 0x%1 with name %2 in file 0x%3 is missing. pThe attribute of type 0x%1 in file 0x%2 is missing. pThe unnamed data attribute in file 0x%1 is missing. `The attribute list in file 0x%1 is missing. The length, 0x%3, of the attribute list entry with attribute of type 0x%1 and instance tag 0x%2 in file 0x%4 is not aligned. The attribute list entry with attribute of type 0x%1 and instance tag 0x%2 in file 0x%6 is incorrect. The attribute list entry name length is 0x%3, and offset 0x%4. The attribute list length is 0x%5. LThe attribute name offset 0x%3 of attribute list entry with attribute of type 0x%1 and instance tag 0x%2 in file 0x%5 is too small. The minimum value is 0x%4. The attribute list length 0x%2 in file 0x%3 is incorrect. The expected value is 0x%1. The extent list of the attribute list is crossed linked at 0x%1 for possibly 0x%2 clusters in file 0x%3. The attribute list entry with attribute of type 0x%1 and instance tag 0x%2 should be after attribute of type 0x%3 and instance tag 0x%4. Two identical attribute list entries of type 0x%1 and instance tag 0x%2 are found. The attribute length 0x%3 of attribute of type 0x%1 and name %2 in file 0x%5 is too small. The minimum value is 0x%4. The sparse flag of attribute of type 0x%1 and name %2 in file 0x%3 is not set. The USN Journal offset 0x%1 in file 0x%2 is not at a page boundary. The USN Journal length 0x%1 in file 0x%3 is too large. The maximum value is 0x%2. The USN Journal length 0x%1 in file 0x%3 is less than its offset 0x%2. The remaining USN block at offset 0x%1 in file 0x%2 is less than a page. The remaining of an USN page at offset 0x%1 in file 0x%2 should be filled with zeros. The USN Journal entry at offset 0x%1 and length 0x%2 crosses the page boundary. The USN Journal entry length 0x%2 at offset 0x%1, in file 0x%4 is larger than the remaining length 0x%3 of a page. The USN Journal entry length 0x%2 at offset 0x%1 in file 0x%4 exceeded the page size 0x%3. The USN Journal entry length 0x%2 at offset 0x%1 in file 0x%3 is not aligned. The USN Journal entry version %2.%3 at offset 0x%1 in file 0x%4 is not recognized. The USN Journal entry length 0x%2 at offset 0x%1 in file 0x%4 is too small. The minimum value is 0x%3. $The remaining USN page length 0x%2 is too small to fit another USN Journal entry at offset 0x%1 in file 0x%4. It needs at least 0x%3 bytes. The USN value 0x%1 of USN Journal entry at offset 0x%2 in file 0x%3 is incorrect. The USN Journal entry at offset 0x%1 in file 0x%4 is not consistence. The entry has length of 0x%3 and a file name length of 0x%2. The USN Journal length 0x%1 in file 0x%4 is less the largest USN encountered, 0x%2, plus eight in file 0x%3. pThe security data stream is missing from file 0x%1. The security data stream size 0x%1 should not be less than 0x%2. The remaining of a security data stream page starting at offset 0x%1 for 0x%2 bytes contains non-zero. The security data stream entry at offset 0x%1 with length 0x%2 crosses the page boundary. The length, 0x%2, of the security data stream entry at offset 0x%1 is too small. The minimum value is 0x%3. The length, 0x%2, of the security data stream entry at offset 0x%1 exceeded the page size 0x%3. The security data stream entry at offset 0x%1 does not fit into the remaining length, 0x%2, of a page. The minimum value is 0x%3. The security descriptor entry with Id 0x%2 at offset 0x%1 is invalid. The security Id 0x%2 of security descriptor entry at offset 0x%1 is a duplicate. The hash value 0x%2 of the security descriptor entry with Id 0x%4 at offset 0x%1 is invalid. The correct value is 0x%3. The offset 0x%2 stored in the security descriptor entry with Id 0x%4 at offset 0x%1 is invalid. The correct value is 0x%3. lThe security descriptor in file 0x%1 is invalid. dThe security Id 0x%1 in file 0x%2 is invalid. The data stream with name %1 in file 0x%2 is not recognized. The attribute definition table length 0x%1 is incorrect. The correct value is 0x%2. tThe attribute definition table content is incorrect. Cluster zero is missing from the data attribute in boot file. TAttribute list found in the log file. The data attribute is either resident or missing in the log file. Unable to obtain the LCN in data attribute of the MFT mirror. There is no physical LCN for VCN 0 in data attribute of the MFT mirror. The data attribute of the MFT mirror is not contiguous for 0x%1 sectors. \The MFT mirror is different from the MFT. pThe data attribute is missing from the upcase file. The upcase file length 0x%1 is incorrect. The expected value is 0x%2. TThe upcase file content is incorrect. The data attribute is either resident or missing in the MFT mirror. The two index entries of length 0x%1 and 0x%2 are either identical or appear in the wrong order. The first index entry of length 0x%1 is a leaf but it is not in the root. The first index entry of length 0x%1 is a leaf but the previous entry is not. Current leaf index entry of length 0x%3 is at depth 0x%2 which is different from other leaf index entry which has a depth of 0x%1. The down pointer of current index entry with length 0x%1 is invalid. The index entry length 0x%1 is too large. The maximum value is 0x%2. \The allocation attribute does not exist. pClearing unused security descriptor stream entries. Mirror security descriptor block different from that of master security descriptor at offset 0x%1. hThe attribute definition table cannot be read. The index buffer at VCN 0x%2 of index %1 in file 0x%3 cannot be read. The MFT mirror starting at cluster 0x%1 for 0x%2 sectors cannot be read. tThe security descriptor in file 0x%1 cannot be read. LThe upcase table cannot be read. The USN attrib of type code 0x%1 and name %2 cannot be read in file 0x%3. The EA Data value length, 0x%1, in file 0x%2 is incorrect. The index entry length 0x%2 for index %1 in file 0x%4 is too large. The maximum value is 0x%3. Unable to query extent list entry 0x%3 from attribute of type 0x%1 and instance tag 0x%2. The total allocated size 0x%1 for attribute of type 0x%3 and instance tag 0x%4 is larger than the allocated length 0x%2. Unable to locate attribute with instance tag 0x%2 and segment reference 0x%3. The expected attribute type is 0x%1. The first index entry offset, 0x%2, for index %1 in file 0x%4 points beyond the length, 0x%3, of the index. VCN is unknown. Some clusters occupied by attribute of type 0x%1 and instance tag 0x%2 in file 0x%3 is already in use. Unable to setup the child file record segment 0x%2 in file 0x%1. The parent 0x%3 of index entry %4 of index %2 in file 0x%5 is incorrect. The expected parent is 0x%1. The file reference 0x%4 of index entry %3 of index %2 with parent 0x%1 is not the same as 0x%5. The file reference 0x%3 of an index entry of index %2 with parent 0x%1 is not the same as 0x%4. Multiple object id index entries in file 0x%1 point to the same file 0x%2. The object id index entry in file 0x%1 points to file 0x%2 which is unreadable. The object id index entry in file 0x%1 points to file 0x%2 which is not in use. The reparse point index entry in file 0x%1 points to file 0x%2 which is not in use. The reparse point index entry in file 0x%1 points to file 0x%2 which is unreadable. ---------------------------------------------------------------------- \Cleaning up instance tags for file 0x%1. \Cleaning up encrypted flag for file 0x%1. XCleaning up sparse flag for file 0x%1. Cleaning up %3 unused index entries from index %2 of file 0x%1. `Cleaning up %1 unused security descriptors. The value length, 0x%1, of the MFT mirror is too small. The minimum value is 0x%2. The valid data length, 0x%1, of the MFT mirror is too small. The minimum value is 0x%2. Index entry %3 of index %2 in file 0x%1 points to unused file 0x%4. An index entry of index %2 in file 0x%1 points to unused file 0x%3. Unable to obtain the LCN in data attribute for VCN 0x%1 of the MFT. An index entry of index %2 in file 0x%1 points to file 0x%3 which is beyond the MFT. pThe segment number 0x%1 in file 0x%2 is incorrect. , Internal Info: The mapping pairs offset 0x%1 for attribute of type 0x%2 and instance tag 0x%3 is not quad aligned. xThe NTFS file name attribute in file 0x%1 is incorrect. tFile 0x%1 only has a standard information attribute. A downpointer (VCN 0x%2) was found in index %1 in file 0x%3 but the index has no index allocation attribute. The sparse flag in standard information attribute in file 0x%1 should not be set. tErrors were found in the Attribute Definition Table. XAttribute list for file %1 is corrupt. \Attribute list for file %1 is unreadable. Attribute list entry with type code %1 in file %2 is corrupt. XAttribute list for file %1 is unsorted. \Errors detected in the Bad Clusters File. LErrors detected in the Boot File. XErrors detected in the uppercase file. xSecurity descriptor for file %1 is missing or invalid. Incorrect information was detected in file record segment %1. tErrors detected in encrypted file record segment %1. lErrors detected in sparse file record segment %1. |Errors detected in reparse point file record segment %1. xAn invalid filename %1 (%3) was found in directory %2. XAll filenames for File %1 are invalid. lMinor file name errors were detected in file %1. Attribute record (%1, %2) from file record segment %3 is corrupt. Attribute records for file record segment %1 are unsorted. PFile record segment %1 is corrupt. `Instance tags need renumbering for file %1. Attribute records from file record segment %1 are badly linked. First free byte offset is incorrect in file record segment %1. XError detected in index %2 for file %1. HIndex %2 in file %1 is corrupt. `Index %2 in file %1 is incorrectly sorted. |Default quota record is missing from index %2 in file %1. Collation rule value for index %1 of file %2 is incorrect. pIndex entry %3 in index %2 of file %1 is incorrect. tAn index entry from index %2 of file %1 is incorrect. Detected a duplicate object id from file record segment %1. dAn error occurred reading the root directory. HCHKDSK is examining lost files. Detected cycles in directory tree. Extra links between parent file %1 and child file %2 detected. Detected orphaned file %1 (%2), should be recovered into directory file %3. LDetected bad clusters in logfile. LDetected errors in the Log File. xDetected errors in the Master File Table (MFT) mirror. TExamining Usn Journal %1 data stream `Examining Usn Journal file record segment. XCHKDSK is examining Usn information... LIndex %1 for file %2 is missing. Examining an index entry with id %3 in index %2 of file %1. hThe security file record segment is incorrect. tIndex %2 of file %1 contains %3 unused index entries. \There are %1 unused security descriptors. The mirror copy of the security descriptors data stream contains errors. pThe security descriptors data stream is unreadable. tExtended attribute information in file %1 is corrupt. Extended attribute set and a reparse point detected in file %1. TFile %1 is missing a data attribute. <File %s is cross-linked. TFile record segment %1 is an orphan. 8Found %1 bad clusters. pCritical master file table (MFT) files are corrupt. hFlags for file record segment %1 are incorrect. The file name in system file record segment %1 contains errors. HThe object id file is missing. PThe reparse point file is missing. @The quota file is missing. The master file table's (MFT) DATA attribute is incorrect. The master file table's (MFT) BITMAP attribute is incorrect. HThe Volume Bitmap is incorrect. The total allocated size in attribute record (%1, %2) of file %3 is incorrect. %1 percent complete. (%2 of %3 file records processed) %r%0 %1 percent complete. (%2 of %3 large file records processed)%r%0 %1 percent complete. (%2 of %3 bad file records processed) %r%0 %1 percent complete. (%2 of %3 EA records processed) %r%0 %1 percent complete. (%2 of %3 reparse records processed) %r%0 %1 percent complete. (%2 of %3 index entries processed) %r%0 %1 percent complete. (%2 of %3 unindexed files scanned) %r%0 %1 percent complete. (%2 of %3 unindexed files recovered) %r%0 %1 percent complete. (%2 of %3 SD bytes processed) %r%0 %1 percent complete. (%2 of %3 file SDs/SIDs processed) %r%0 %1 percent complete. (%2 of %3 data files processed) %r%0 %1 percent complete. (%2 of %3 USN bytes processed) %r%0 %1 percent complete. (%2 of %3 files processed) %r%0 %1 percent complete. (%2 of %3 free clusters processed) %r%0  %1 file records processed. %r%0  %1 large file records processed. %r%0  %1 bad file records processed. %r%0  %1 EA records processed. %r%0  %1 reparse records processed. %r%0  %1 index entries processed. %r%0  %1 unindexed files scanned. %r%0  %1 unindexed files recovered to lost and found. %r%0  %1 security descriptor bytes processed. %r%0  %1 file SDs/SIDs processed. %r%0  %1 data files processed. %r%0  %1 USN bytes processed. %r%0  %1 files processed. %r%0  %1 free clusters processed. %r%0 pCHKDSK is compacting the security descriptor stream XRecreating deleted index %2 in file %1. A scan is already running on this drive. Chkdsk can not run more than one scan on a drive at a time. X Lost and found is located at \%1 t %1 unindexed files recovered to original directory. PThere is no help for this utility. @Critical error encountered. <Incorrect Windows version Converts a FAT volume to NTFS. CONVERT volume /FS:NTFS [/V] [/CvtArea:filename] [/NoSecurity] [/X] volume Specifies the drive letter (followed by a colon), mount point, or volume name. /FS:NTFS Specifies that the volume will be converted to NTFS. /V Specifies that Convert will be run in verbose mode. /CvtArea:filename Specifies a contiguous file in the root directory that will be the place holder for NTFS system files. /NoSecurity Specifies that the security settings on the converted files and directories allow access by all users. /X Forces the volume to dismount first if necessary. All open handles to the volume will not be valid. 8Invalid Parameter - %1 @Must specify a file system DInvalid drive specification. HCannot CONVERT a network drive. D%1 is not a valid file system |Conversion from %1 volume to %2 volume is not available. The conversion will take place automatically the next time the system restarts. hCannot determine location of system directory. Could not find file %1 Make sure that the required file exists and try again. |Could not schedule an automatic conversion of the drive. The %1 drive is already scheduled for an automatic conversion. DConverting drive %1 to %2... 8Drive %1 is already %2. Could not check volume %1 for errors. The conversion to %2 did not take place. |The /C option is only valid with the /UNCOMPRESS option. Determining disk space required for file system conversion... TTotal disk space: %1 KB TFree space on volume: %1 KB TSpace required for conversion: %1 KB 8Converting file system `%1 percent completed. %r%0 0Conversion complete pThe conversion failed. %1 was not converted to %2 The conversion has probably failed. %1 may not be converted to %2 8Error during disk read 8Error during disk write 0Insufficient Memory XInsufficient disk space for conversion hCannot relocate existing file system structures tCannot create the elementary file system structures. @Error reading directory %1 Error converting directory %1. The directory may be damaged or there may be insufficient disk space. Error converting file %1. The file may be damaged or there may be insufficient disk space. @Error converting file data. TCannot convert an extended attribute. A file contains extended attributes, but the extended attribute file was not found. XCannot locate or create an NTFS index. PThis volume cannot be converted to %1. Possible causes are: 1.- Bad sectors in required areas of the volume. 2.- %2 structures in areas required by %1. lConvert cannot gain exclusive access to the %1 drive, so it cannot convert it now. Would you like to schedule it to be converted the next time the system restarts (Y/N)? %0 The %1 file system is not enabled. The volume will not be converted. xUnsupported sector size. Cannot convert volume to %1.  The file system has been converted. Please wait while the system restarts. The specified drive is the system partition on an ARC-compliant system; its file system cannot be converted @The disk geometry recorded in the volume's Bios Parameter Block differs from the geometry reported by the driver. This volume cannot be converted to %1. Name table translation is not available for conversion to %1. tThe volume is too fragmented to be converted to NTFS. Cannot find the utility library which contains CHKDSK for the %1 file system. This volume cannot be converted to %2. L%1 cannot be converted because it contains files or directories with reserved NTFS names in the root directory. There can be no files or directories named $Mft, $MftMirr, $LogFile, $Volume, $AttrDef, $BitMap, $Boot, $BadClus, $Secure, $UpCase, $Extend or $Quota in the root directory. lThis drive is dirty and cannot be converted. You will need to clear the dirty bit on this drive by running CHKDSK /F or allowing AUTOCHK to run on it the next time you reboot. The file %1 specified to the /CvtArea option cannot be found at the root. The file %1 specified to the /CvtArea option must be in one contiguous block. The name %1 specified to the /CvtArea option must be a file name. Convert cannot run because the volume is in use by another process. Convert may run if this volume is dismounted first. ALL OPENED HANDLES TO THIS VOLUME WOULD THEN BE INVALID. Would you like to force a dismount on this volume? (Y/N) %0 XConvert failed to dismount the volume. %1 XUnable to set security attributes (%1). Unable to schedule the setting of security attributes (%1). pCannot convert %1. The volume is write protected. TCannot CONVERT volume on this device. WARNING! The file specified to /CvtArea is too small and its space will not be used. A file of at least %1 MB is needed. This conversion will also remove your previous operating system backup. Do you want to continue? (Y/N) %0 dUnable to delete uninstall backup image - %1 Unable to notify other components that this volume has changed. Convert has relocated existing file system structures. A restart of your computer is necessary in order for convert to continue. LParameter format not correct - %1 4Active code page: %1 ,Invalid code page dDisplays or sets the active code page number. CHCP [nnn] nnn Specifies a code page number. Type CHCP without a parameter to display the active code page number. (Internal error. <Invalid macro definition.  Edits command lines, recalls Windows commands, and creates macros. DOSKEY [/REINSTALL] [/LISTSIZE=size] [/MACROS[:ALL | :exename]] [/HISTORY] [/INSERT | /OVERSTRIKE] [/EXENAME=exename] [/MACROFILE=filename] [macroname=[text]] /REINSTALL Installs a new copy of Doskey. /LISTSIZE=size Sets size of command history buffer. /MACROS Displays all Doskey macros. /MACROS:ALL Displays all Doskey macros for all executables which have Doskey macros. /MACROS:exename Displays all Doskey macros for the given executable. /HISTORY Displays all commands stored in memory. /INSERT Specifies that new text you type is inserted in old text. /OVERSTRIKE Specifies that new text overwrites old text. /EXENAME=exename Specifies the executable. /MACROFILE=filename Specifies a file of macros to install. macroname Specifies a name for a macro you create. text Specifies commands you want to record. UP and DOWN ARROWS recall commands; ESC clears command line; F7 displays command history; ALT+F7 clears command history; F8 searches command history; F9 selects a command by number; ALT+F10 clears macro definitions. The following are some special codes in Doskey macro definitions: $T Command separator. Allows multiple commands in a macro. $1-$9 Batch parameters. Equivalent to %%1-%%9 in batch programs. $* Symbol replaced by everything following macro name on command line. To specify the size of the command history buffer under Window NT, use the /listsize switch which sets the number of commands to remember. \Insufficient memory to grow DOSKEY list. \Associates a path with a drive letter. 4Drive already SUBSTed SUBST [drive1: [drive2:]path] SUBST drive1: /D drive1: Specifies a virtual drive to which you want to assign a path. [drive2:]path Specifies a physical drive and path you want to assign to a virtual drive. /D Deletes a substituted (virtual) drive. Type SUBST with no parameters to display a list of current virtual drives. %1: => %2 8Invalid parameter - %1 PIncorrect number of parameters - %1 0Path not found - %1 0Access denied - %1 XCHKNTFS: Incorrect command-line format. 8Invalid parameter - %1 tCHKNTFS: drive specifiers may not contain wildcards. TDisplays or modifies the checking of disk at boot time. CHKNTFS volume [...] CHKNTFS /D CHKNTFS /T[:time] CHKNTFS /X volume [...] CHKNTFS /C volume [...] volume Specifies the drive letter (followed by a colon), mount point, or volume name. /D Restores the machine to the default behavior; all drives are checked at boot time and chkdsk is run on those that are dirty. /T:time Changes the AUTOCHK initiation countdown time to the specified amount of time in seconds. If time is not specified, displays the current setting. /X Excludes a drive from the default boot-time check. Excluded drives are not accumulated between command invocations. /C Schedules a drive to be checked at boot time; chkdsk will run if the drive is dirty. If no switches are specified, CHKNTFS will display if the specified drive is dirty or scheduled to be checked on next reboot. XSpecify only one of /D, /X, /C, and /T. \You must specify at least one drive name. X%1 is not a valid drive specification. HCannot query state of drive %1 %1 is dirty. You may use the /C option to schedule chkdsk for this drive. ,%1 is not dirty. <Drive %1 does not exist. lCHKNTFS cannot be used for the network drive %1. hCHKNTFS cannot be used for the cdrom drive %1. `CHKNTFS cannot be used for the ram disk %1. xUnable to enable automatic volume upgrade on drive %1. pSkipping drive %1 because it is not an NTFS volume. XCHKNTFS does not work on floppy drive. Skipping drive %1 because it is not an NTFS, FAT, or FAT32 volume. The volume %1 does not have a mount point or drive letter. Chkdsk has been scheduled manually to run on next reboot on volume %1. The specified AUTOCHK initiation countdown time cannot be less than zero or larger than %1 seconds. The default is %2 seconds. tUnable to set the AUTOCHK initiation countdown time. The AUTOCHK initiation countdown time is set to %1 second(s). HRemove disks or other media.%0 $Disk error%0 @Press any key to restart%0 An operating system wasn't found. Try disconnecting any drives that don't contain an operating system.%0 8BOOTMGR is compressed%0 DA disk read error occurred%0 HPress Ctrl+Alt+Del to restart%0 HVolume %1 is UDF version %2.%3. tThe volume in %1 contains an unsupported UDF version. <Checking File System %1. Invalid System Stream detected. System stream information is lost. The volume was not previously closed properly and may contain errors. H CHKDSK is verifying ICBs ... @ICB verification completed. TCHKDSK is looking for orphan ICBs ... DSearch for orphans completed. LCHKDSK is verifying ICB links ... LICB link verification completed. DFound orphan ICB at block %1. Correcting invalid Information Length %2 to %3 in ICB at block %1. tCorrecting Recorded Blocks field in ICB at block %1. Correcting invalid Object Size %2 to %3 in ICB at block %1. Error in allocation descriptors for ICB at block %1. Truncating invalid allocation descriptors. Cross linked allocation for ICB at block %1. Deleting cross linked ICB allocation. Multiple non-identical parent FID found in directory ICB at block %1. |Duplicate parent FID found in directory ICB at block %1. Parent FID found in the middle of directory ICB at block %1. Deleting parent FID pointing to ICB at block %2 in directory ICB at block %1. Deleting FID pointing to ICB at block %2 in directory ICB at block %1. Adding parent FID pointing to ICB at block %2 in directory ICB at block %1. Adding FID pointing to ICB at block %2 in directory ICB at block %1. Modifying flags to 0x%3 for FID pointing to ICB at block %2 in directory ICB at block %1. Deleting Stream ICB entry in stream ICB at block %1. Hierarchical streams not allowed in UDF xCHKDSK is verifying link counts and parent entries ... pLink count and parent entry verification completed. Deleting stream ICB entry pointing to ICB at block %2 in ICB at block %1. lReferences found to non-existent ICB at block %1. xMultiple references found to directory ICB at block %1. Mismatch between parent FID and in-reference found to directory ICB at block %1. pParent FID not found in directory ICB at block %1. xInvalid parent FID found in directory ICB at block %1. Adding stream ICB entry pointing to ICB at block %2 in ICB at block %1. Mismatch between in-references and file type for for ICB at block %1. |Multiple references found to file stream ICB at block %1. Mismatch between parent FID references and file type for for ICB at block %1. \Incorrect link count for ICB at block %1. Modifying Root ICB location in File Set Descriptor to block %1. Creating a new directory ICB at block %1 with parent ICB at block %2. \Creating a new directory ICB at block %1 Found invalid references to root directory ICB at block %1 Found invalid references to system stream directory ICB at block %1 Deleting system stream directory ICB entry in File Set Descriptor. dCreating new File Set Descriptor at block %1. tCorrecting errors in File Set Descriptor at block %1. lCreating new Space Bitmap Descriptor at block %1. |Correcting errors in Space Bitmap Descriptor at block %1. tCorrecting errors in the Volume Descriptor Sequence. |File Set Descriptor at block %1 is corrupt or unreadable. Space Bitmap Descriptor at block %1 is corrupt or unreadable. Main Volume Descriptor Sequence is corrupt or unreadable. Attempting to read the Reserve Volume Descriptor Sequence. Reserve Volume Descriptor Sequence is corrupt or unreadable. Correcting the Main Volume Descriptor Sequence using the Reserve Volume Descriptor Sequence. Correcting the Reserve Volume Descriptor Sequence using the Main Volume Descriptor Sequence. XCannot fix Volume Descriptor Sequence. Cannot define a logical volume using main or reserve Volume Descriptor Sequence. Chkdsk aborted. Correcting cycles in directory tree. Breaking links between parent ICB at block %1 and child ICB at block %2. LCHKDSK is identifying lost files. PLost file identification completed. lCHKDSK is checking the directory tree for cycles. LCHKDSK is checking system files. Deleting corrupt Extented Attribute ICB in ICB at block %1. Deleting Extended Attribute ICB entry in stream ICB at block %1. Only a file or directory ICB can have extended attributes in UDF. < %1 KB total disk space. 0%1 KB in %2 files. <%1 KB in %2 directories. P%1 KB in %2 alternate data streams. H%1 KB in %2 stream directories. @%1 KB in use by the system. @%1 KB available on disk. < %1 MB total disk space. 0%1 MB in %2 files. <%1 MB in %2 directories. P%1 MB in %2 alternate data streams. H%1 MB in %2 stream directories. @%1 MB in use by the system. @%1 MB available on disk. File type %1 in ICB tag not supported in UDF. Chkdsk aborted. ICB strategy type %1 in ICB tag not supported in UDF. Chkdsk aborted. Only unallocated space bitmap is supported for free space management in UDF. Chkdsk aborted. Correcting file count to %1 in Logical Volume Integrity Descriptor. Correcting directory count to %1 in Logical Volume Integrity Descriptor. Cannot fix Logical Volume Integrity Descriptor. Chkdsk aborted. Deleting the unique ID system stream since the volume has been modified. Found corrupt FID pointing to directory ICB at block %2 in stream directory ICB at block %1. Found invalid file identifier in FID pointing to ICB at block %2 in directory ICB at block %1. Cannot read Anchor Volume Descriptor Pointer. Chkdsk aborted. Deleting corrupt Extented Attribute Space in ICB at block %1. `Chkdsk cannot be run on this type of media. tFound mismatch in Anchor Volume Descriptor Pointers. One or more Anchor Volume Descriptor Pointers are missing. Fixing Anchor Volume Descriptor Pointer at block %1 with prevailing Anchor Volume Descriptor Pointer. pReseting invalid ICB tag flags in ICB at block %1. CHKDSK is verifying object size for ICBs with alternate data streams ... XICB object size verification completed. Correcting partition size for partition %1 to %2 in Logical Volume Integrity Descriptor. Correcting partition free space for partition %1 to %2 in Logical Volume Integrity Descriptor. pSparing Table at block %1 is corrupt or unreadable. Found mismatching Sparing Tables with identical sequence numbers. Modifying System Stream Directory ICB location in File Set Descriptor to block %1. xNon-allocatable Space Stream is corrupt or unreadable. xCreating new Non-allocatable Space Stream at block %1. Sparing Table missing or unreadable on media that is not Target Defect Managed. 4Invalid partition reference in Extended Attribute ICB entry. Deleting Extended Attribute ICB entry pointing to ICB at block %2 in ICB at block %1. ,Invalid partition reference in Stream Directory ICB entry. Deleting Stream Directory ICB entry pointing to ICB at block %2 in ICB at block %1. Invalid partition reference in FID. Deleting FID pointing to ICB at block %2 in directory ICB at block %1.  Chkdsk is running on media that does not support writes in place. On such media chkdsk operation is limited to verifying the presence of a valid VAT on the last written block and if necessary searching for the last valid VAT and placing it at the end of the disk. This could revert the media to a previous state before the corruption occured. Chkdsk could not find a valid VAT at the end of the volume. \ CHKDSK is searching for a valid VAT ... <Search for VAT completed. hChkdsk could not find a valid VAT on the media. Chkdsk is copying last valid VAT at block %1 to the end of the volume. This will revert the volume to its state at %2:%3 on %4/%5/%6. There is no writable space available in the physical partition to write a new valid VAT. Invalid flags in FID. Deleting FID pointing to ICB at block %2 in directory ICB at block %1. hReserve Sparing Table not present on the disk. dCreating Reserve Sparing Table at sector %1. |Insufficient free space to create Reserve Sparing Table. xCreating Main Volume Descriptor Sequence at sector %1. Insufficient free space to create Main Volume Descriptor Sequence. |Creating Reserve Volume Descriptor Sequence at sector %1. Insufficient free space to create Reserve Volume Descriptor Sequence. Correcting errors in Unallocated Space Descriptor in the Volume Descriptor Sequence. xCorrecting errors in Anchor Volume Descriptor Pointer. xCannot fix errors in Anchor Volume Descriptor Pointer. A background low-level format of the media is in progress. Windows will avoid writes to the end of the media to allow early eject. This is not a corruption. Chkdsk will fix the media for UDF compliance in future when the background format is complete. \Low level format of CD/DVD media failed.. xUnsupported UDF version in Volume Descriptor Sequence. `Main metadata file at block %1 is corrupt. dMirror metadata file at block %1 is corrupt. dMetadata bitmap file at block %1 is corrupt. DCreating new Metadata Bitmap. TCorrecting errors in Metadata Bitmap. hCreating new Metadata Bitmap File at block %1. hCreating new Metadata Mirror File at block %1. Insufficient free space to create duplicate metadata. Switching to non-duplicated metadata for logical volume. Correcting inconsistencies between main and mirror metadata. Correcting number of partitions to %1 in Logical Volume Integrity Descriptor. FID references block beyond the end of the partition. Deleting FID pointing to ICB at block %2 in directory ICB at block %1. The disk contains structures that are not supported in UDF %1.%2. Chkdsk aborted. tCreating new Non-allocatable Space File at block %1. tNon-allocatable Space File is corrupt or unreadable. Logical Volume Integrity Descriptor at block %1 is corrupt. Creating new Logical Volume Integrity Descriptor at block %1. Background format is incomplete, skipping reserve AVDP and VDS checks. pAn error occurred while examining the boot region. tCorruption was found while examining the boot region. |An error occurred while examining files and directories. Corruption was found while examining files and directories. tAn error occurred while examining the volume bitmap. xCorruption was found while examining the volume bitmap. hAn error occurred while recovering lost files. Corruption was found while examining files in directory %1 (%2). Both copies of the boot information for this volume are corrupt. Chkdsk cannot continue. An error occurred while examining the free space on the volume. Bad sectors were found and tested while examining free space on the volume. The volume has been successfully checked, but Windows was unable to mark the volume as clean. dThe file allocation table (FAT) is corrupted. lVolume label (15 characters, ENTER for none)? %0 DThe volume label is too long. Corruption due to bad sectors was found while examining files in directory %1. Entries %2 to %3 were affected. The bad sectors will only be repaired if the "/r" option is specified. A media error has been detected. Bad sectors may be present on the volume. dThe volume will be checked for bad sectors. `The cluster size must be a minimum of 16KB. Floppy disks cannot be formatted with the ReFS file system. Failed to initialize underlying data structures status %1. You can only use /FREEORPHANEDCHAINS or /MARKCLEAN on FAT/FAT32/exFAT. \/F and /MARKCLEAN are mutually exclusive. T Examining %1 corruption records ... T Examining %1 corruption record ... l %1 corruption records processed in %2 seconds. h %1 corruption record processed in %2 seconds. 4 Record %1 of %2: %0 @corruption found and fixed. ,corruption found. 4no corruption found. Dunexpected corruption found. <Corrupt File "%1" ... %0 `Unused file metadata marked as used ... %0 %1 Bad clusters in file "%2" starting at file offset %3 ... %0 %1 Bad free clusters starting at logical cluster %2 ... %0 File "%1" and file "%2" both own logical clusters [%3, %4) ... %0 File "%1" and file "%2" both own logical cluster %3 ... %0 Corrupt security descriptor entry at offset %2 in %1:$SDS ... %0 `%1 files have an invalid security ID ... %0 \File %1 has an invalid security ID ... %0 XBad index "%1" in directory "%2" ... %0 pBad subtree in index "%1" of directory "%2" ... %0 lCorruption in index "%1" of directory "%2" ... %0 Unneeded index entry in index "%1" of directory "%2" ... %0 pIndex "%1" of directory "%2" is mis-ordered ... %0 |Missing %1 entries in index "%3" of directory "%2" ... %0 Index entry for file "%1" is missing from index "%3" of directory "%2" ... %0 Cycle beginning at directory "%1" and ending in directory "%2" ... %0 %1 clusters allocated to file "%2" at offset "%3" are marked as free ... %0 Adding %1 lost files to index "%3" of directory "%2" ... %0 Adding lost file "%1" to index "%3" of directory "%2" ... %0 lSecurity ID %1 is non-existent and unused ... %0 Index "%1" of directory "%2" is partially mis-ordered ... %0 hIndex "%1" of directory "%2" has a cycle ... %0 Windows has found problems and they were all fixed online. No further action is required. 4Windows has found problems and some were fixed online; the remaining problems must be fixed offline. Please run chkdsk /spotfix to fix the issues. Windows has found problems that must be fixed offline. Please run chkdsk /spotfix to fix the issues. Windows has found problems and encountered online repair failure -- "chkdsk /f" required. Snapshot creation failed. CHKDSK cannot perform an online scan of the volume. l Snapshot was deleted. CHKDSK cannot continue. "chkdsk /scan" is aborting due to self-healing command failure: %1 "chkdsk /f" will be required to repair the volume. pDeleted duplicate filename %1 (%3) in directory %2. lFound duplicate filename %1 (%3) in directory %2. `Scanning and repairing drive: %1%% complete t Stage 1: Examining basic file system structure ... ` Stage 2: Examining file name linkage ... d Stage 3: Examining security descriptors ... | Stage 4: Looking for bad clusters in user file data ... d Stage 5: Looking for bad, free clusters ... h Found corrupt basic file structure for "%1" d Found unused file metadata marked as used  Found %1 bad clusters in file "%2" starting at file offset %3  Found %1 bad free clusters starting at logical cluster %2  File "%1" and file "%2" both own logical clusters [%3, %4) x File "%1" and file "%2" both own logical cluster %3  Found corrupt security descriptor entry at offset %2 in %1:$SDS  Found %1 files (%2) which refer to a non-existent security descriptor %3  File %1 refers to a non-existent security descriptor %2 d Found a bad index "%1" in directory "%2" x Found a bad subtree in index "%1" of directory "%2" t Found corruption in index "%1" of directory "%2"  Found an unneeded link (%1) in index "%2" of directory "%3" x Found a mis-ordered index "%1" from directory "%2"  Found %1 missing entries (%2) in index "%3" of directory "%4"  Found missing Index entry for file "%1" from index "%3" of directory "%2"  Found %1 lost files (%2); requesting reconnection to index "%3" of directory "%4"  Found lost file "%1"; requesting reconnection to index "%2" of directory "%3"  Found a naming cycle beginning at directory "%1" and ending in directory "%2"  Found %1 clusters allocated to file "%2" at offset "%3" marked as free p Found a cycle in index "%1" from directory "%2"  Found a partially mis-ordered index "%1" from directory "%2" Progress: %4 of %5 done; Stage: %1%%; Total: %2%%; ETA: %6:%7:%8 %9%r%0  %r%0 X Found %1 files (%2) with bad links T Found a file "%1" with bad links d Security ID %1 is non-existent and unused D ... repaired online. X ... queued for offline repair. tself-healing requires we abort and restart the scan. unexpected outcome from self-healing -- "chkdsk /f" required. was not able to send command for self-healing due to lack of memory. "Chkdsk /scan" is restarting due to stale information about crosslinks. lScanning and repairing drive (%1): %2%% complete HScanning and repairing drive... TScanning and repairing drive (%1)... "Chkdsk /scan" has found volume bitmap corruption which can only be repaired by "chkdsk /f". Aborting. "Chkdsk /scan" has found and repaired critical volume bitmap corruption online and must restart the scan. "chkdsk /scan" is aborting due to corruption found in the $Boot file. "chkdsk /f" will be required to repair the volume. "Force Full Chkdsk" volume state is set -- spotfix is not possible. Windows has examined the list of previously identified issues and found no problems. No further action is required. There is no list of previously identified issues associated with this drive. No further action is required. Windows has examined the list of previously identified potential issues and found no problems. No further action is required. There is no list of previously identified potential issues associated with this drive. No further action is required. dWindows has examined the list of previously identified potential issues and found problems. Please run chkdsk /scan to fully analyze the problems and queue them for repair. 4Windows could not verify the list of previously identified potential issues. Please run chkdsk /scan to find the problems and queue them for repair. 0Windows cannot perform an online scan on the volume because it is in the "Full Chkdsk Needed" state. Please run "chkdsk /f" to repair the volume. lThe ReFS file system does not need to be checked. <%1!*s!Corruption Record: T%1!*s!Corruption Record: %2!#018llx! $%1!*s!Header: 0%1!*s!Description: @%1!*s!Verb-Specific Fields: NoOp%0 ,ForceFullChkdsk%0 4ForceProactiveScan%0 BadFRS%0 ,OrphanChildFRS%0 $BadClusters%0 ,BadFreeClusters%0 CrossLink%0 ,CorruptSDEntry%0 0InvalidSecurityId%0 ,IndexAttribute%0 (IndexSubtree%0 $IndexOffset%0 $IndexEntry%0 $IndexOrder%0 Connect%0 $BreakCycle%0 $FRSAllocate%0 IndexSort%0 $IndexCycle%0 Unknown%0 TESTING%0 4DETECTED_IN_DRIVER%0 0GLOBALLY_VERIFIED%0 0SKIP_SELF_HEALING%0 <SELF_HEALING_ATTEMPTED%0 0TESTED_DUPLICATE%0 DUPLICATE%0 ,PREVENTS_MOUNT%0 $MAINTENANCE%0 CRITICAL%0 $SPECULATIVE%0 P%1!*s!LCN : %2!#018llx! \%1!*s!Run Length : %2!#010x! P%1!*s!Block %2!d! : %3!#018llx! L%1!*s!Corruption Context %2!2d!: CallStack%0 ,TestInformation%0 (BinarySample%0 0SelfHealingResult%0 ,%1!*s!Attribute: T%1!*s!TypeCode: %2!#x! Name: %3!.*s! T%1!*s!Version : %2!1d!.%3!1d! D%1!*s!Flags : %2!s! P%1!*s!Length : %2!d! bytes H%1!*s!InstanceTag : %2!38s! D%1!*s!Verb : %2!s! h%1!*s!FRN : %2!#06x! %3!04x!`%4!08x! D%1!*s!ChildFRS Count : %2!d! h%1!*s!ChildFRS %2!d! : %3!#06x! %4!04x!`%5!08x! $%1!*s!Extent: 8%1!*s!Owning Extent : 8%1!*s!Crossing Extent : P%1!*s!Offset : %2!#018llx! L%1!*s!Security Id : %2!#010x! D%1!*s!FRN Count : %2!d! `%1!*s!FRN %2!d! : %3!#06x! %4!04x!`%5!08x! 8%1!*s!Index : P%1!*s!Value Length : %2!d! bytes ,Key : 8%1!*s!Value : L%1!*s!Block Offset : %2!#010x! h%1!*s!Recover FRN : %2!#06x! %3!04x!`%4!08x! h%1!*s!Parent FRN : %2!#06x! %3!04x!`%4!08x! h%1!*s!Child FRN : %2!#06x! %3!04x!`%4!08x! |%1!*s!VCN: %2!#018llx! LCN: %3!#018llx! Length: %4!#010x! 0%1!*s!FileName: %2 NtfsFileName: ParentDirectory: %1!#04x! %2!04x!`%3!08x! Info: CreationTime: %4!#016llx! LastModificationTime: %5!#016llx! LastChangeTime: %6!#016llx! LastAccessTime: %7!#016llx! AllocatedLength: %8!#016llx! FileSize: %9!#016llx! FileAttributes: %10!#08x! PackedEaSize: %11!#04x! Reserved: %12!#04x! ReparsePointTag: %13!#04x! $ Flags: %0 ,FILE_NAME_NTFS%0 (FILE_NAME_DOS%0 ,OwnerID: %1!#08x! ReparseIndexKey: FileReparseKey: %1!#08x! FileId: %2!#04x! %3!04x!`%4!08x! SecurityHashKey: Hash: %1!#08x! SecurityId: %2!#08x! 4SecurityId: %1!#08x! NtfsObjectIdInfo: FileSystemReference: %2!#04x! %3!04x!`%4!08x! , ExtendedInfo: ,DEFAULT_LIMITS%0 (LIMIT_REACHED%0 $ID_DELETED%0 XQuotaUserData: QuotaVersion: %1!#08x! QuotaFlags: %2!s! QuotaUsed: %3!#016llx! QuotaChangeTime: %4!#016llx! QuotaThreshold: %5!#016llx! QuotaLimit: %6!#016llx! QuotaExceededTime: %7!#016llx! QuotaSid: %8!s! @SecurityDescriptorHeader: SecurityHashKey: Hash: %1!#08x! SecurityId: %2!#08x! Offset: %3!#016llx! Length: %4!#08x! P%1!*s!Block : %2!#018llx! D%1!*s!Entry Ordinal : %2!d! D%1!*s!Block Count : %2!d! <%1!*s!Context Type : %2 %1!*s!Data: \STALE_UNNAMED_INDEX_ENTRY_POINTS_TO_FRS%0 dINCORRECT_FRS_MULTI_SECTOR_HEADER_SIGNATURE%0 HFRS_USA_OFFSET_BELOW_MINIMUM%0 @INCORRECT_FRS_USA_OFFSET%0 <INCORRECT_FRS_USA_SIZE%0 DINCORRECT_FIRST_ATTR_OFFSET%0 8INCORRECT_FRS_HEADER%0 BAD_FRS%0 @INCORRECT_SEQUENCE_NUMBER%0 @INCORRECT_SEGMENT_NUMBER%0 HATTR_RECORD_OFFSET_TOO_LARGE%0 PATTR_RECORD_LENGTH_CANNOT_BE_ZERO%0 HATTR_RECORD_LENGTH_MISALIGNED%0 8ATTR_RECORD_TOO_LARGE%0 @INCORRECT_FIRST_FREE_BYTE%0 DATTR_LOWEST_VCN_IS_NOT_ZERO%0 0INVALID_FILE_ATTR%0 8MISSING_STANDARD_INFO%0 TMISSING_FILE_NAME_INDEX_PRESENT_BIT%0 LFILE_NAME_INDEX_PRESENT_BIT_SET%0 HCANNOT_FIND_UNNAMED_DATA_ATTR%0 LMISSING_SPARSE_FLAG_IN_STD_INFO%0 PNTFS_SPARSE_FLAG_SET_IN_STD_INFO%0 TMISSING_ENCRYPTED_FLAG_IN_STD_INFO%0 \MISSING_REPARSE_POINT_FLAG_IN_STD_INFO%0 TREPARSE_POINT_FLAG_SET_IN_STD_INFO%0 0BAD_MAPPING_PAIRS%0 <INVALID_ATTR_FORM_CODE%0 HATTR_RECORD_LENGTH_TOO_SMALL%0 <ATTR_SHOULD_BE_RESIDENT%0 HINCORRECT_STD_INFO_ATTR_SIZE%0 @ATTR_SHOULD_NOT_HAVE_NAME%0 <INSTANCE_TAG_TOO_LARGE%0 <DUPLICATED_INSTANCE_TAG%0 DATTR_SHOULD_NOT_BE_RESIDENT%0 DINCORRECT_ATTR_NAME_OFFSET%0 <NULL_FOUND_IN_ATTR_NAME%0 LUNKNOWN_ATTR_TO_ATTR_DEF_TABLE%0 DATTR_SHOULD_NOT_BE_INDEXED%0 <ATTR_SHOULD_BE_INDEXED%0 TINDEXABLE_ATTR_SHOULD_NOT_HAVE_NAME%0 8ATTR_SHOULD_BE_NAMED%0 8ATTR_LENGTH_TOO_SMALL%0 4ATTR_LENGTH_TOO_BIG%0 <INCORRECT_RESIDENT_ATTR%0 <RESIDENT_ATTR_COLLISION%0 lNON_RESIDENT_ATTR_HAS_BAD_MAPPING_PAIRS_OFFSET%0 xNON_RESIDENT_ATTR_HAS_UNALIGNED_MAPPING_PAIRS_OFFSET%0 pNON_RESIDENT_ATTR_MAPPING_PAIRS_OFFSET_TOO_SMALL%0 DNON_RESIDENT_ATTR_COLLISION%0 LINVALID_NON_RESIDENT_ATTR_SIZES%0 XINVALID_NON_RESIDENT_ATTR_TOTAL_ALLOC%0 dINVALID_NON_RESIDENT_ATTR_TOTAL_ALLOC_BLOCK%0 \BAD_FILE_NAME_LENGTH_IN_FILE_NAME_VALUE%0 HINCONSISTENT_FILE_NAME_VALUE%0 dNULL_FOUND_IN_FILE_NAME_OF_FILE_NAME_VALUE%0 4CROSS_LINK_DETECTED%0 DMISSING_PARENT_IN_FILE_NAME%0 4MISSING_INDEX_ENTRY%0 dINDEX_ENTRY_FILE_NAME_HAS_INCORRECT_PARENT%0 LINCORRECT_INDEX_ENTRY_FILE_REF%0 4MFT_BITMAP_NOT_SET%0 4INVALID_SECURITY_ID%0 XINCORRECT_INDEX_ENTRY_FILE_NAME_FLAGS%0 XDOS_NTFS_NAMES_HAVE_DIFFERENT_PARENTS%0 TNTFS_FILE_NAME_ALREADY_ENCOUNTERED%0 PDOS_FILE_NAME_ALREADY_ENCOUNTERED%0 0MISSING_DOS_NAME%0 0MISSING_NTFS_NAME%0 HDOS_NTFS_NAMES_ARE_IDENTICAL%0 ,CLEARING_IN_USE%0 @REPAIRING_SEQUENCE_NUMBER%0 @REPAIRING_FIRST_FREE_BYTE%0 @REPAIRING_SEGMENT_NUMBER%0 @REPAIRING_FILE_ATTRIBUTES%0 4DELETING_ATTRIBUTE%0 DREPAIRING_FILE_RECORD_FLAGS%0 (ADD_ATTRIBUTE%0 8DELETING_INDEX_ENTRY%0 HDELETING_GENERIC_INDEX_ENTRY%0 8MFT_OFFSET_TOO_LARGE%0 <FILE_RECORD_NOT_IN_USE%0 4FILE_RECORD_REUSED%0 @MISSING_BASE_FILE_RECORD%0 (FILE_DELETED%0 ,BITMAP_CORRUPT%0 4PAGING_FILE_CORRUPT%0 $MFT_CORRUPT%0 4SYSTEM_FILE_CORRUPT%0 8ATTRIBUTE_LIST_FOUND%0 OBJECT_ID%0 $REPARSE_ID%0 ,SET_MFT_BITMAP%0 8REPAIRING_SECURITY_ID%0 4ADDING_INDEX_ENTRY%0 4SET_FILE_NAME_FLAGS%0 0STALE_INFORMATION%0 4ATTRIBUTE_NOT_FOUND%0 0SET_VOLUME_BITMAP%0 4CLEAR_VOLUME_BITMAP%0 <CLUSTERS_ALREADY_IN_USE%0 $INVALID_VCN%0 $INVALID_LCN%0 4INVALID_RUN_LENGTH%0 (LCN_NOT_EXIST%0 @FILE_NAME_ATTRIBUTE_ONLY%0 DINVALID_ARRAY_LENGTH_COUNT%0 8STD_INFO_NON_RESIDENT%0 (SDS_NOT_FOUND%0 4STD_INFO_TOO_SMALL%0 SID_VALID%0 $DENY_DEFRAG%0 <%1!*s!SelfHealingContext: H%1!*s!CorruptionHint%2!1d!: %3 P%1!*s!CorruptionResolution1: %2!s! `%1!*s!CorruptionResolution2: (%2!#018llx!) 4%1!*s!NtfsCallStack: <%1!*s!File: %2!d! <%1!*s!Line Number: %2!d! <%1!*s!SourceTag: %2!d! ,%1!*s!Call Stack: $%1!*s!%2!.*S! %1!*s!%2 d%1!*s!Invalid or malformed corruption record! 4VS_VERSION_INFO # 98 # 98?StringFileInfo040904B0LCompanyNameMicrosoft CorporationNFileDescriptionAuto Check Utility3FileVersion10.0.14393.2339 (rs1_release_inmarket.180611-1502)0InternalNameAutoChk.LegalCopyright Microsoft Corporation. All rights reserved.@ OriginalFilenameAutoChk.Exej%ProductNameMicrosoft Windows Operating SystemDProductVersion10.0.14393.2339DVarFileInfo$Translation k%sΉϣ%}-* rP{*,   MUI MUI en-US  (08@HPX`hpxȠРؠ (08@HPX`hpxȡСء (08@HPX`hpxȢТآ (08@HPX`hpxȣУأ (08@HPX`hpxȤФؤ (08@HPX`hpxȥХإ (08@HPX`hpxȦЦئ (08@HPX`hpxȧЧا (08@HPX`hpxȨШب (08@HPX`hpxȩЩة (08@HPX`hpxȪЪت (08@HPX`hpxȫЫث (08@HPX`hpxȬЬج (08@HPX`hpxȭЭح (08@HPX`hpxȮЮخ (08@HPX`hpxȯЯد0 p (08@HPX`hpxȠРؠ (08@HPX`hpxȡСء (08@HPX`hpxȢТآ (08@HPX`hpxȣУأ (08@HPX`hpȤФؤ (08@HPX`hpxإP 8Hx